Gene Gene information from NCBI Gene database.
Entrez ID 8553
Gene name Basic helix-loop-helix family member e40
Gene symbol BHLHE40
Synonyms (NCBI Gene)
BHLHB2Clast5DEC1HLHB2SHARP-2SHARP2STRA13Stra14
Chromosome 3
Chromosome location 3p26.1
Summary This gene encodes a basic helix-loop-helix protein expressed in various tissues. The encoded protein can interact with ARNTL or compete for E-box binding sites in the promoter of PER1 and repress CLOCK/ARNTL`s transactivation of PER1. This gene is believe
miRNA miRNA information provided by mirtarbase database.
986
miRTarBase ID miRNA Experiments Reference
MIRT018020 hsa-miR-335-5p Microarray 18185580
MIRT039240 hsa-miR-454-3p CLASH 23622248
MIRT036578 hsa-miR-941 CLASH 23622248
MIRT608450 hsa-miR-8485 HITS-CLIP 19536157
MIRT608449 hsa-miR-329-3p HITS-CLIP 19536157
Transcription factors Transcription factors information provided by TRRUST V2 database.
6
Transcription factor Regulation Reference
ARNT Unknown 12354771
ARNTL Activation 19032342
CLOCK Activation 19032342
NR1H3 Activation 19032342
VDR Unknown 23220548
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
50
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 12397359, 12624110, 14672706, 15193144, 18411297
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604256 1046 ENSG00000134107
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14503
Protein name Class E basic helix-loop-helix protein 40 (bHLHe40) (Class B basic helix-loop-helix protein 2) (bHLHb2) (Differentially expressed in chondrocytes protein 1) (DEC1) (Enhancer-of-split and hairy-related protein 2) (SHARP-2) (Stimulated by retinoic acid gene
Protein function Transcriptional repressor involved in the regulation of the circadian rhythm by negatively regulating the activity of the clock genes and clock-controlled genes (PubMed:12397359, PubMed:18411297). Acts as the negative limb of a novel autoregulat
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 53 108 Helix-loop-helix DNA-binding domain Domain
PF07527 Hairy_orange 141 180 Hairy Orange Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in cartilage, spleen, intestine, lung, and to a lesser extent in heart, brain, liver, muscle and stomach.
Sequence
MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLI
EKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALT
NLIDQQQQKIIA
LQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVS
ELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTD
TDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGH
FTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAA
ALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD
Sequence length 412
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Circadian rhythm