Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	85480
Gene name	Thymic stromal lymphopoietin
Gene symbol	TSLP
Synonyms (NCBI Gene)	-
Chromosome	5
Chromosome location	5q22.1
Summary	This gene encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attract

Show/Hide all (57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017769	hsa-miR-335-5p	Microarray	18185580
MIRT527990	hsa-miR-652-5p	PAR-CLIP	22012620
MIRT527989	hsa-miR-6732-3p	PAR-CLIP	22012620
MIRT527988	hsa-miR-4323	PAR-CLIP	22012620
MIRT527987	hsa-miR-3943	PAR-CLIP	22012620
MIRT527986	hsa-miR-6769a-3p	PAR-CLIP	22012620
MIRT527985	hsa-miR-211-3p	PAR-CLIP	22012620
MIRT527984	hsa-miR-4270	PAR-CLIP	22012620
MIRT527983	hsa-miR-4441	PAR-CLIP	22012620
MIRT527982	hsa-miR-6754-5p	PAR-CLIP	22012620
MIRT527981	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT527980	hsa-miR-1266-5p	PAR-CLIP	22012620
MIRT527979	hsa-miR-4518	PAR-CLIP	22012620
MIRT527978	hsa-miR-5699-5p	PAR-CLIP	22012620
MIRT527977	hsa-miR-299-5p	PAR-CLIP	22012620
MIRT527990	hsa-miR-652-5p	PAR-CLIP	22012620
MIRT527989	hsa-miR-6732-3p	PAR-CLIP	22012620
MIRT527988	hsa-miR-4323	PAR-CLIP	22012620
MIRT527987	hsa-miR-3943	PAR-CLIP	22012620
MIRT527986	hsa-miR-6769a-3p	PAR-CLIP	22012620
MIRT527985	hsa-miR-211-3p	PAR-CLIP	22012620
MIRT527984	hsa-miR-4270	PAR-CLIP	22012620
MIRT527983	hsa-miR-4441	PAR-CLIP	22012620
MIRT527982	hsa-miR-6754-5p	PAR-CLIP	22012620
MIRT527981	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT527980	hsa-miR-1266-5p	PAR-CLIP	22012620
MIRT527979	hsa-miR-4518	PAR-CLIP	22012620
MIRT527978	hsa-miR-5699-5p	PAR-CLIP	22012620
MIRT527977	hsa-miR-299-5p	PAR-CLIP	22012620
MIRT2358610	hsa-miR-128	CLIP-seq
MIRT2358611	hsa-miR-1305	CLIP-seq
MIRT2358612	hsa-miR-27a	CLIP-seq
MIRT2358613	hsa-miR-27b	CLIP-seq
MIRT2358614	hsa-miR-302a	CLIP-seq
MIRT2358615	hsa-miR-302b	CLIP-seq
MIRT2358616	hsa-miR-302c	CLIP-seq
MIRT2358617	hsa-miR-302d	CLIP-seq
MIRT2358618	hsa-miR-302e	CLIP-seq
MIRT2358619	hsa-miR-3692	CLIP-seq
MIRT2358620	hsa-miR-372	CLIP-seq
MIRT2358621	hsa-miR-373	CLIP-seq
MIRT2358622	hsa-miR-4255	CLIP-seq
MIRT2358623	hsa-miR-4659a-3p	CLIP-seq
MIRT2358624	hsa-miR-4659b-3p	CLIP-seq
MIRT2358625	hsa-miR-4719	CLIP-seq
MIRT2358626	hsa-miR-4778-3p	CLIP-seq
MIRT2358627	hsa-miR-513b	CLIP-seq
MIRT2358628	hsa-miR-519a	CLIP-seq
MIRT2358629	hsa-miR-519b-3p	CLIP-seq
MIRT2358630	hsa-miR-519c-3p	CLIP-seq
MIRT2358631	hsa-miR-520a-3p	CLIP-seq
MIRT2358632	hsa-miR-520b	CLIP-seq
MIRT2358633	hsa-miR-520c-3p	CLIP-seq
MIRT2358634	hsa-miR-520d-3p	CLIP-seq
MIRT2358635	hsa-miR-520e	CLIP-seq
MIRT2358636	hsa-miR-548t	CLIP-seq
MIRT2358637	hsa-miR-607	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
NFKB1	Unknown	22270071
RELA	Unknown	22270071

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001961	Process	Positive regulation of cytokine-mediated signaling pathway	IBA
GO:0001961	Process	Positive regulation of cytokine-mediated signaling pathway	IDA	11418668
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	11418668, 20974963
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	IMP	17242164
GO:0005139	Function	Interleukin-7 receptor binding	IBA
GO:0005139	Function	Interleukin-7 receptor binding	IMP	11480573
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IDA	11418668, 17242164, 24850429
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	IMP	11480573
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	11418668, 35321112
GO:0005615	Component	Extracellular space	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	11480573
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	11418668
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	11480573
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	10881176
GO:0032722	Process	Positive regulation of chemokine production	IBA
GO:0032722	Process	Positive regulation of chemokine production	IDA	11418668
GO:0032733	Process	Positive regulation of interleukin-10 production	IBA
GO:0032733	Process	Positive regulation of interleukin-10 production	IMP	17242164
GO:0032736	Process	Positive regulation of interleukin-13 production	IBA
GO:0032736	Process	Positive regulation of interleukin-13 production	IMP	17242164
GO:0032754	Process	Positive regulation of interleukin-5 production	IBA
GO:0032754	Process	Positive regulation of interleukin-5 production	IMP	17242164
GO:0032755	Process	Positive regulation of interleukin-6 production	IBA
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	17242164
GO:0033005	Process	Positive regulation of mast cell activation	IMP	17242164
GO:0038111	Process	Interleukin-7-mediated signaling pathway	IDA	11480573
GO:0043066	Process	Negative regulation of apoptotic process	IDA	11480573
GO:0050729	Process	Positive regulation of inflammatory response	IBA
GO:0050729	Process	Positive regulation of inflammatory response	IMP	17242164
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	24850429
GO:0050832	Process	Defense response to fungus	IDA	24850429
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	24850429
GO:0071654	Process	Positive regulation of chemokine (C-C motif) ligand 1 production	IMP	17242164
GO:0071657	Process	Positive regulation of granulocyte colony-stimulating factor production	IMP	17242164
GO:1904894	Process	Positive regulation of receptor signaling pathway via STAT	IDA	24850429
GO:1904894	Process	Positive regulation of receptor signaling pathway via STAT	IDA	11418668, 24850429

MIM	HGNC	e!Ensembl
607003	30743	ENSG00000145777

Q969D9

Protein name

Thymic stromal lymphopoietin

Protein function

[Isoform 1]: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c(+) dendritic cells. Can induce allergic inflammation by directly activating mast cells. {ECO:00002

PDB

5J11 , 5J12 , 5J13 , 8QFZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15216	TSLP	29 → 153	Thymic stromal lymphopoietin	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is expressed in a number of tissues including heart, liver and prostate. Isoform 2 is the predominant form in keratinocytes of oral mucosa, skin and in salivary glands. It is secreted into saliva. {ECO:0000269|PubMed:11480573

Sequence

MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKS
TEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINA
TQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Sequence length

159

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction JAK-STAT signaling pathway		Interleukin-7 signaling

TSLP (thymic stromal lymphopoietin)