DNAJC5B (DnaJ heat shock protein family (Hsp40) member C5 beta)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
85479
Gene name Gene Name - the full gene name approved by the HGNC.
DnaJ heat shock protein family (Hsp40) member C5 beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DNAJC5B
Synonyms (NCBI Gene) Gene synonyms aliases
CSP-beta
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q13.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the DNAJ heat shock protein 40 family of co-chaperone proteins that is characterized by an N-terminal DNAJ domain, a linker region, and a cysteine-rich C-terminal domain. The encoded protein, together with heat shock protein
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(15)
miRTarBase ID miRNA Experiments Reference
MIRT941750 hsa-miR-3119 CLIP-seq
MIRT941751 hsa-miR-3140-3p CLIP-seq
MIRT941752 hsa-miR-375 CLIP-seq
MIRT941753 hsa-miR-4273 CLIP-seq
MIRT941754 hsa-miR-4677-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(3)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956
GO:0005737 Component Cytoplasm IEA
GO:0016020 Component Membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
613945 24138 ENSG00000147570
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Q9UF47
Protein name DnaJ homolog subfamily C member 5B (Cysteine-string protein isoform beta) (CSP-beta)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00226 DnaJ 19 → 81 DnaJ domain Domain
Tissue specificity TISSUE SPECIFICITY: Testis specific.
Sequence 
MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEK
FKEINNAHAILTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLL
TGCYFCCCLCCCCNCCCGHCRPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTN
ANEKTQLIKEGSRSYCTDS
Sequence length 199
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG  
  Protein processing in endoplasmic reticulum  
<