FCN3 (ficolin 3)

Gene

• Entrez ID: 8547
• Gene name: Ficolin 3
• Gene symbol: FCN3
• Synonyms (NCBI Gene): FCNH, HAKA1
• Chromosome: 1
• Chromosome location: 1p36.11
• Summary: Ficolins are a group of proteins which consist of a collagen-like domain and a fibrinogen-like domain. In human serum, there are two types of ficolins, both of which have lectin activity. The protein encoded by this gene is a thermolabile beta-2-macroglyc

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT994064	hsa-miR-185	CLIP-seq
MIRT994065	hsa-miR-4306	CLIP-seq
MIRT994066	hsa-miR-4644	CLIP-seq
MIRT994067	hsa-miR-4700-3p	CLIP-seq
MIRT994068	hsa-miR-4718	CLIP-seq
MIRT994069	hsa-miR-4768-3p	CLIP-seq
MIRT994070	hsa-miR-892b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001867	Process	Complement activation, lectin pathway	IBA
GO:0001867	Process	Complement activation, lectin pathway	IDA	18204047, 22691502, 23386610
GO:0001867	Process	Complement activation, lectin pathway	IDA	11907111, 26133042
GO:0001867	Process	Complement activation, lectin pathway	IEA
GO:0001905	Process	Activation of membrane attack complex	IDA	18204047
GO:0002376	Process	Immune system process	IEA
GO:0002752	Process	Cell surface pattern recognition receptor signaling pathway	NAS	17215869
GO:0003823	Function	Antigen binding	IBA
GO:0003823	Function	Antigen binding	IDA	22851708
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	11907111, 19939495, 21035894, 22854970, 23460739, 23785123, 27141819, 32094208
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005581	Component	Collagen trimer	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	NAS	11907111
GO:0006508	Process	Proteolysis	IDA	11907111
GO:0006956	Process	Complement activation	IDA	26841934, 30111885, 37852260
GO:0006956	Process	Complement activation	IDA	22851708
GO:0008228	Process	Opsonization	IDA	3897448, 8538770
GO:0009897	Component	External side of plasma membrane	NAS	11907111
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030246	Function	Carbohydrate binding	TAS	9694814
GO:0031012	Component	Extracellular matrix	IBA
GO:0031638	Process	Zymogen activation	IDA	22691502, 23386610
GO:0031640	Process	Killing of cells of another organism	IDA	30552328
GO:0038187	Function	Pattern recognition receptor activity	IDA	9694814
GO:0042802	Function	Identical protein binding	IPI	19109177
GO:0043654	Process	Recognition of apoptotic cell	IDA	15804047
GO:0045087	Process	Innate immune response	IEA
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IMP	22851708
GO:0046872	Function	Metal ion binding	IEA
GO:0051604	Process	Protein maturation	IDA	6906228, 18204047, 22691502
GO:0051607	Process	Defense response to virus	IDA	22851708
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0097367	Function	Carbohydrate derivative binding	IBA
GO:0097367	Function	Carbohydrate derivative binding	IDA	9694814
GO:0106139	Component	Symbiont cell surface	IDA	26133042
GO:1902679	Process	Negative regulation of RNA biosynthetic process	IDA	22851708
GO:1903028	Process	Positive regulation of opsonization	IDA	11907111
GO:1905370	Component	Serine-type endopeptidase complex	IDA	11907111

Other IDs

• MIM: 604973
• HGNC: 3625
• e!Ensembl: ENSG00000142748

Protein

• UniProt ID: O75636
• Protein name: Ficolin-3 (Collagen/fibrinogen domain-containing lectin 3 p35) (Collagen/fibrinogen domain-containing protein 3) (Hakata antigen)
• Protein function: May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Has affinity with GalNAc, GlcNAc, D-fucose, as mono/oligosaccharide and lipopolysaccharides from S.typhimurium and
• PDB: 2J5Z, 2J60, 2J64
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00147	Fibrinogen_C	89 → 299	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Liver and lung. In liver it is produced by bile duct epithelial cells and hepatocytes. In lung it is produced by both ciliated bronchial epithelial cells and type II alveolar epithelial cells. {ECO:0000269|PubMed:10330454}.
• Sequence:

  MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPG
  PQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVF
  CDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELR
  VELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDS
  SNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR

• Sequence length: 299

Pathways

Reactome:

Lectin pathway of complement activation
Initial triggering of complement
Ficolins bind to repetitive carbohydrate structures on the target cell surface

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Familial cancer of breast	Uncertain significance	rs148234540, rs141300199	RCV005933403 RCV005909295
FCN3-related disorder	Uncertain significance; Likely benign	rs148234540, rs28385723, rs373443059, rs142397200, rs2522436682, rs147142056	RCV003954698 RCV003948680 RCV003894601 RCV003914427 RCV003924254 RCV003934285
Immunodeficiency due to ficolin3 deficiency	Uncertain significance; Likely benign; Benign	rs781053078, rs56405086, rs532781899, rs746674895, rs199689497, rs746300270, rs28385652, rs141300199	RCV001332306 RCV002496032 RCV000005603 RCV003147231 RCV003147232 RCV003224645 RCV002495346 RCV002504380
Lung cancer	Uncertain significance	rs141300199	RCV005909296
Microcephaly	Uncertain significance	rs761615129	RCV001252824
Nonpapillary renal cell carcinoma	Uncertain significance	rs1362558341	RCV005927291
Rheumatic heart disease	risk factor; Uncertain significance	rs4494157, rs10794501	RCV001280946 RCV001280947
Sarcoma	Uncertain significance	rs148234540	RCV005933404
Uterine corpus endometrial carcinoma	Uncertain significance	rs148234540	RCV005933405

Associations from Text Mining
Disease Name	Relationship Type	References
Adenocarcinoma of Lung	Inhibit	39390580
Aortic Aneurysm Abdominal	Stimulate	28039962
Arthritis Rheumatoid	Associate	32820945
Autoimmune Diseases	Associate	36263058
Brain Neoplasms	Inhibit	33878734
Carcinoma Hepatocellular	Associate	17006932, 33878734, 37484802
Carcinoma Hepatocellular	Inhibit	35402624, 36632465
Carcinoma Squamous Cell	Associate	33717076
Carcinoma Squamous Cell	Inhibit	39390580
Cardiomyopathies	Associate	36863704
Cardiomyopathy Hypertrophic	Associate	35126952, 38006610
COVID 19	Stimulate	33221483
Cross Infection	Associate	32047495
Diabetes Mellitus Type 2	Associate	18795103, 22471352
Essential Hypertension	Associate	22471352
Genetic Diseases Inborn	Associate	35264221
Hematologic Diseases	Associate	38219652
Hypertension	Associate	22471352
Immunologic Deficiency Syndromes	Associate	19535802
Infections	Associate	26133042, 32047495
Leprosy	Associate	28241035
Leprosy Lepromatous	Stimulate	28241035
Lung Neoplasms	Associate	39390580
Lupus Erythematosus Systemic	Associate	38219652
Lymphoma	Associate	32047495
Lymphopenia	Associate	38219652
Neoplasms	Associate	23744477, 33717076, 35402624, 37484802
Neoplasms	Inhibit	35422093
Neovascularization Pathologic	Associate	38087190
Ovarian Neoplasms	Associate	23744477
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	32601370
Primary Immunodeficiency Diseases	Associate	35264221
Primary Ovarian Insufficiency	Associate	34641644
Respiratory Tract Infections	Stimulate	26133042
Respiratory Tract Infections	Associate	33591573
Rheumatic Fever	Stimulate	33499929
Rheumatic Heart Disease	Associate	33499929, 40340734
Scoliosis	Inhibit	21647955
Sepsis	Inhibit	20528471
Thrombosis	Inhibit	33878734
Tuberculosis Pulmonary	Associate	33591573