Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	85465
Gene name	Selenoprotein I
Gene symbol	SELENOI
Synonyms (NCBI Gene)	EPT1SELISEPISPG81
Chromosome	2
Chromosome location	2p23.3
Summary	The multi-pass transmembrane protein encoded by this gene belongs to the CDP-alcohol phosphatidyltransferase class-I family. It catalyzes the transfer of phosphoethanolamine from CDP-ethanolamine to diacylglycerol to produce phosphatidylethanolamine, whic

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs933233143	G>A,C	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1572337800	A>G	Pathogenic	Splice acceptor variant, intron variant

Show/Hide all (63)

miRTarBase ID	miRNA	Experiments	Reference
MIRT715558	hsa-miR-382-3p	HITS-CLIP	19536157
MIRT715557	hsa-miR-496	HITS-CLIP	19536157
MIRT159073	hsa-miR-579-3p	HITS-CLIP	19536157
MIRT159092	hsa-miR-664b-3p	HITS-CLIP	19536157
MIRT703907	hsa-miR-8080	HITS-CLIP	23313552
MIRT703908	hsa-miR-6758-5p	HITS-CLIP	23313552
MIRT703906	hsa-miR-6856-5p	HITS-CLIP	23313552
MIRT703905	hsa-miR-6783-5p	HITS-CLIP	23313552
MIRT703904	hsa-miR-1324	HITS-CLIP	23313552
MIRT703903	hsa-miR-5187-3p	HITS-CLIP	23313552
MIRT703902	hsa-miR-4533	HITS-CLIP	23313552
MIRT703901	hsa-miR-4747-5p	HITS-CLIP	23313552
MIRT703900	hsa-miR-5196-5p	HITS-CLIP	23313552
MIRT703899	hsa-miR-4271	HITS-CLIP	23313552
MIRT703898	hsa-miR-4725-3p	HITS-CLIP	23313552
MIRT703897	hsa-miR-6780b-5p	HITS-CLIP	23313552
MIRT159034	hsa-miR-3646	HITS-CLIP	23313552
MIRT703896	hsa-miR-7-1-3p	HITS-CLIP	23313552
MIRT703895	hsa-miR-7-2-3p	HITS-CLIP	23313552
MIRT703894	hsa-miR-3065-5p	HITS-CLIP	23313552
MIRT703893	hsa-miR-6736-3p	HITS-CLIP	23313552
MIRT688358	hsa-miR-6872-3p	HITS-CLIP	23313552
MIRT703892	hsa-miR-875-3p	HITS-CLIP	23313552
MIRT703891	hsa-miR-5093	HITS-CLIP	23313552
MIRT703890	hsa-miR-5581-3p	HITS-CLIP	23313552
MIRT703889	hsa-miR-188-3p	HITS-CLIP	23313552
MIRT703888	hsa-miR-1260a	HITS-CLIP	23313552
MIRT703887	hsa-miR-1260b	HITS-CLIP	23313552
MIRT703886	hsa-miR-3156-3p	HITS-CLIP	23313552
MIRT703884	hsa-miR-4709-3p	HITS-CLIP	23313552
MIRT688363	hsa-miR-582-3p	HITS-CLIP	23313552
MIRT688362	hsa-miR-590-3p	HITS-CLIP	23313552
MIRT688361	hsa-miR-4438	HITS-CLIP	23313552
MIRT119821	hsa-miR-5582-5p	HITS-CLIP	23313552
MIRT159048	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT688360	hsa-miR-4269	HITS-CLIP	23313552
MIRT688359	hsa-miR-6715b-5p	HITS-CLIP	23313552
MIRT688358	hsa-miR-6872-3p	HITS-CLIP	23313552
MIRT688357	hsa-miR-4735-5p	HITS-CLIP	23313552
MIRT688356	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT688355	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT688354	hsa-miR-5589-3p	HITS-CLIP	23313552
MIRT688353	hsa-miR-4775	HITS-CLIP	23313552
MIRT688352	hsa-miR-5095	HITS-CLIP	23313552
MIRT688351	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT688350	hsa-miR-4715-3p	HITS-CLIP	23313552
MIRT688349	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT688348	hsa-miR-129-5p	HITS-CLIP	23313552
MIRT545514	hsa-miR-3200-5p	PAR-CLIP	21572407
MIRT545512	hsa-miR-4267	PAR-CLIP	21572407
MIRT545513	hsa-miR-6730-3p	PAR-CLIP	21572407
MIRT545511	hsa-miR-3660	PAR-CLIP	21572407
MIRT545510	hsa-miR-4526	PAR-CLIP	21572407
MIRT545509	hsa-miR-6719-3p	PAR-CLIP	21572407
MIRT545508	hsa-miR-3117-5p	PAR-CLIP	21572407
MIRT206239	hsa-miR-6512-3p	PAR-CLIP	21572407
MIRT206240	hsa-miR-6720-5p	PAR-CLIP	21572407
MIRT159007	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT158990	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT159000	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT005265	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT159005	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT159007	hsa-miR-374a-5p	HITS-CLIP	22473208

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004307	Function	Ethanolaminephosphotransferase activity	IBA
GO:0004307	Function	Ethanolaminephosphotransferase activity	IDA	17132865
GO:0004307	Function	Ethanolaminephosphotransferase activity	IEA
GO:0004307	Function	Ethanolaminephosphotransferase activity	IMP	28052917, 29500230
GO:0004307	Function	Ethanolaminephosphotransferase activity	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	28052917
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005794	Component	Golgi apparatus	IBA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006646	Process	Phosphatidylethanolamine biosynthetic process	IBA
GO:0006646	Process	Phosphatidylethanolamine biosynthetic process	IDA	17132865
GO:0006646	Process	Phosphatidylethanolamine biosynthetic process	IEA
GO:0006646	Process	Phosphatidylethanolamine biosynthetic process	IMP	28052917, 29500230
GO:0008611	Process	Ether lipid biosynthetic process	IEA
GO:0008611	Process	Ether lipid biosynthetic process	ISS
GO:0008654	Process	Phospholipid biosynthetic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016780	Function	Phosphotransferase activity, for other substituted phosphate groups	IEA
GO:0042552	Process	Myelination	IEA
GO:0042552	Process	Myelination	ISS
GO:0046474	Process	Glycerophospholipid biosynthetic process	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
607915	29361	ENSG00000138018

Q9C0D9

Protein name

Ethanolaminephosphotransferase 1 (hEPT1) (EC 2.7.8.1) (Selenoprotein I) (SelI)

Protein function

Ethanolaminephosphotransferase that catalyzes the transfer of phosphoethanolamine (PE) from CDP-ethanolamine to lipid acceptors, the final step in the synthesis of PE via the 'Kennedy' pathway (PubMed:17132865, PubMed:28052917, PubMed:29500230).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01066	CDP-OH_P_transf	48 → 129	CDP-alcohol phosphatidyltransferase	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Abundant in brain, placenta, liver and pancreas, followed by heart, skeletal muscle, lung and kidney. In brain it is strongly expressed in cerebellum, followed by the occipital pole and the frontal lobe. {ECO:0000269|

Sequence

MAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAPNLITFSGFLL
VVFNFLLMAYFDPDFYASAPGHKHVPDWVWIVVGILNFVAYTLDGVDGKQARRTNSSTPL
GELFDHGLDSWSCVYFVVTVYSIFGRGSTGVSVFVLYLLLWVVLFSFILSHWEKYNTGIL
FLPWGYDISQVTISFVYIVTAVVGVEAWYEPFLFNFLYRDLFTAMIIGCALCVTLPMSLL
NFFRSYKNNTLKLNSVYEAMVPLFSPCLLFILSTAWILWSPSDILELHPRVFYFMVGTAF
ANSTCQLIVCQMSSTRCPTLNWLLVPLFLVVLVVNLGVASYVESILLYTLTTAFTLAHIH
YGVRVVKQLSSHFQIYPFSLRKPNSDULGMEEKNIGL

Sequence length

397

Interactions

View interactions

	KEGG		Reactome
	Phosphonate and phosphinate metabolism Glycerophospholipid metabolism Ether lipid metabolism Metabolic pathways		Synthesis of PE

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Spastic paraplegia 81, autosomal recessive	Pathogenic	rs2465282305, rs1466246912, rs933233143, rs1572337800	RCV003322650 RCV003322651 RCV001003409 RCV001003410

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs77604836, rs61910683	RCV005915614 RCV005908523
Cervical cancer	Benign	rs61910683	RCV005908525
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	rs77604836	RCV005915620
Colon adenocarcinoma	Benign	rs61910683	RCV005908522
Gastric cancer	Benign	rs77604836, rs61910683	RCV005915617 RCV005908527
Lung cancer	Benign	rs61910683	RCV005908528
Malignant lymphoma, large B-cell, diffuse	Benign	rs77604836	RCV005915616
Malignant tumor of esophagus	Benign	rs77604836, rs61910683	RCV005915615 RCV005908524
Ovarian serous cystadenocarcinoma	Benign	rs77604836	RCV005915618
Sarcoma	Benign	rs61910683	RCV005908526
Uterine corpus endometrial carcinoma	Benign	rs77604836, rs61910683	RCV005915619 RCV005908529

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Blindness	Associate	29500230
Bulbo Spinal Atrophy X Linked	Associate	28052917
Demyelinating Diseases	Associate	29500230
Heredodegenerative Disorders Nervous System	Associate	28052917
Lung Neoplasms	Associate	33408336
Microphthalmia Syndromic 10	Associate	29500230
Seizures	Associate	29500230
Spastic Paraplegia Hereditary	Associate	28052917, 29500230

SELENOI (selenoprotein I)