Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
85416
Gene name Gene Name - the full gene name approved by the HGNC.
Zic family zinc finger 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZIC5
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q32.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. The encoded protein may act as a transcriptional repressor. Studies in mouse and Xenopus support a role for this gene in neural crest development. Elevated expression of this
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019534 hsa-miR-340-5p Sequencing 20371350
MIRT021085 hsa-miR-186-5p Sequencing 20371350
MIRT021906 hsa-miR-128-3p Sequencing 20371350
MIRT023467 hsa-miR-23b-3p Sequencing 20371350
MIRT024611 hsa-miR-215-5p Microarray 19074876
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0005634 Component Nucleus IBA 21873635
GO:0006357 Process Regulation of transcription by RNA polymerase II IBA 21873635
GO:0007417 Process Central nervous system development IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
617896 20322 ENSG00000139800
Protein
UniProt ID Q96T25
Protein name Zinc finger protein ZIC 5 (Zinc finger protein of the cerebellum 5)
Protein function Essential for neural crest development, converting cells from an epidermal fate to a neural crest cell fate. Binds to DNA (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18366 zf_ZIC 422 453 Zic proteins zinc finger domain Domain
PF00096 zf-C2H2 491 515 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 551 575 Zinc finger, C2H2 type Domain
Sequence
MFLKAGRGNKVPPVRVYGPDCVVLMEPPLSKRNPPALRLADLATAQVQPLQNMTGFPALA
GPPAHSQLRAAVAHLRLRDLGADPGVATTPLGPEHMAQASTLGLSPPSQAFPAHPEAPAA
AARAAALVAHPGAGSYPCGGGSSGAQPSAPPPPAPPLPPTPSPPPPPPPPPPPALSGYTT
TNSGGGGSSGKGHSRDFVLRRDLSATAPAAAMHGAPLGGEQRSGTGSPQHPAPPPHSAGM
FISASGTYAGPDGSGGPALFPALHDTPGAPGGHPHPLNGQMRLGLAAAAAAAAAELYGRA
EPPFAPRSGDAHYGAVAAAAAAALHGYGAVNLNLNLAAAAAAAAAGPGPHLQHHAPPPAP
PPPPAPAQHPHQHHPHLPGAAGAFLRYMRQPIKQELICKWIDPDELAGLPPPPPPPPPPP
PPPPAGGAKPCSKTFGTMHELVNHVTVEHVGGPEQSSHVCFWEDCPREGKPFKAKYKLIN
HIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKK
HSHVHTSDKPYYCKIRGCDKSYTHPSSLRKHMKIHCKSPPPSPGPLGYSSVGTPVGAPLS
PVLDPARSHSSTLSPQVTNLNEWYVCQASGAPSHLHTPSSNGTTSETEDEEIYGNPEVVR
TIH
Sequence length 663
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Anencephaly Iniencephaly, Exencephaly rs773607884 15136147
Neural tube defect Neural Tube Defects rs121434297, rs137853061, rs137853062, rs768434408, rs777661576, rs747846362, rs200137991, rs780014899, rs574132670, rs786204013, rs147257424, rs763539350, rs776483190, rs781461462, rs1114167354
View all (26 more)
15136147
Unknown
Disease term Disease name Evidence References Source
Uterine Fibroids Uterine Fibroids GWAS
Alzheimer disease Alzheimer disease GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35733175
Adenoma Associate 33423702
Central Nervous System Vascular Malformations Associate 17209130
Colonic Neoplasms Associate 35593226
Colorectal Neoplasms Associate 29024195, 31392276
COVID 19 Associate 35733175
Dandy Walker Syndrome Associate 17209130
Glioma Associate 34475426
Holoprosencephaly Associate 20531442
Lymphoma Non Hodgkin Stimulate 34475426