Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	85413
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 22 member 16
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC22A16
Synonyms (NCBI Gene) Gene synonyms aliases	CT2, FLIPT2, HEL-S-18, OAT6, OCT6, OKB1, dJ261K5.1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q21\|6q21-q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the organic zwitterion transporter protein family which transports carnitine. The encoded protein has also been shown to transport anticancer drugs like bleomycin (PMID: 20037140) successful treatment has been correlated with

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019055	hsa-miR-335-5p	Microarray	18185580

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005275	Function	Amine transmembrane transporter activity	IDA	15963465
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IC	15963465
GO:0005886	Component	Plasma membrane	IDA	12089149, 20037140
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007338	Process	Single fertilization	IMP	12089149
GO:0015101	Function	Organic cation transmembrane transporter activity	IBA
GO:0015101	Function	Organic cation transmembrane transporter activity	IDA	12089149, 15963465, 20037140
GO:0015226	Function	Carnitine transmembrane transporter activity	IDA	12089149, 20037140
GO:0015226	Function	Carnitine transmembrane transporter activity	TAS
GO:0015606	Function	Spermidine transmembrane transporter activity	IDA	20037140
GO:0015695	Process	Organic cation transport	IBA
GO:0015695	Process	Organic cation transport	IDA	15963465
GO:0015695	Process	Organic cation transport	IDA	12089149, 20037140
GO:0015837	Process	Amine transport	IEA
GO:0015879	Process	Carnitine transport	IDA	12089149
GO:0015879	Process	Carnitine transport	IDA	12089149
GO:0016020	Component	Membrane	IDA	12089149
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030317	Process	Flagellated sperm motility	IMP	12089149
GO:0046717	Process	Acid secretion	IDA	12089149
GO:0055085	Process	Transmembrane transport	IEA
GO:1902603	Process	Carnitine transmembrane transport	IDA	12089149, 20037140
GO:1903711	Process	Spermidine transmembrane transport	IDA	20037140

MIM	HGNC	e!Ensembl
608276	20302	ENSG00000004809

Protein

UniProt ID

Q86VW1

Protein name

Solute carrier family 22 member 16 (Carnitine transporter 2) (CT2) (Fly-like putative transporter 2) (FLIPT2) (Flipt 2) (Organic cation transporter OKB1) (Organic cation/carnitine transporter 6)

Protein function

Facilitative organic cation transporter that mediates the transport of carnitine as well as the polyamine spermidine (PubMed:12089149, PubMed:20037140). Mediates the partially Na(+)-dependent bidirectional transport of carnitine (PubMed:12089149

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00083	Sugar_tr	103 → 538	Sugar (and other) transporter	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in testis and epididymis (at protein level) (PubMed:12089149, PubMed:12384147, PubMed:15963465). Expressed in endometrium (at protein level); highly expressed during the normal secretory phase, but expression is significantly

Sequence

MGSRHFEGIYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRPPGNVSQ
VVFHNHSNWSLEDTGALLSSGQKDYVTVQLQNGEIWELSRCSRNKRENTSSLGYEYTGSK
KEFPCVDGYIYDQNTWKSTAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLG
RRVVLWATSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRT
WASVHLHSFFAVGTLLVALTGYLVRTWWLYQMILSTVTVPFILCCWVLPETPFWLLSEGR
YEEAQKIVDIMAKWNRASSCKLSELLSLDLQGPVSNSPTEVQKHNLSYLFYNWSITKRTL
TVWLIWFTGSLGFYSFSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAY
SLFCSALACGVVMVIPQKHYILGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGS
GSMVCRLASILAPFSVDLSSIWIFIPQLFVGTMALLSGVLTLKLPETLGKRLATTWEEAA
KLESENESKSSKLLLTTNNSGLEKTEAITPRDSGLGE

Sequence length

577

Interactions

View interactions

	Reactome
			Organic cation transport

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Melanoma	Melanoma	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abnormalities Drug Induced	Associate	35648061
Bipolar Disorder	Associate	19308960
Breast Neoplasms	Associate	20179710, 28036387, 32235849
Drug Related Side Effects and Adverse Reactions	Associate	20179710
Febrile Neutropenia	Associate	28036387
Heredodegenerative Disorders Nervous System	Associate	35648061
Leukemia	Associate	12384147
Lymphoma Large B Cell Diffuse	Associate	26314988
Nasopharyngeal Carcinoma	Associate	31770211
Neoplasms	Associate	35648061
Parkinson Disease	Associate	35648061
Tachycardia Atrioventricular Nodal Reentry	Associate	32235849

SLC22A16 (solute carrier family 22 member 16)