Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8537
Gene name Gene Name - the full gene name approved by the HGNC.
Brain enriched myelin associated protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BCAS1
Synonyms (NCBI Gene) Gene synonyms aliases
AIBC1, NABC1, PMES-2
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene resides in a region at 20q13 which is amplified in a variety of tumor types and associated with more aggressive tumor phenotypes. Among the genes identified from this region, it was found to be highly expressed in three amplified breast cancer c
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT608863 hsa-miR-3650 HITS-CLIP 24906430
MIRT608862 hsa-miR-933 HITS-CLIP 24906430
MIRT608861 hsa-miR-6867-5p HITS-CLIP 24906430
MIRT608860 hsa-miR-574-5p HITS-CLIP 24906430
MIRT441802 hsa-miR-3123 PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IEA
GO:0005737 Component Cytoplasm ISS
GO:0042552 Process Myelination IBA
GO:0042552 Process Myelination ISS
GO:0070062 Component Extracellular exosome HDA 23533145
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602968 974 ENSG00000064787
Protein
UniProt ID O75363
Protein name Breast carcinoma-amplified sequence 1 (Amplified and overexpressed in breast cancer) (Novel amplified in breast cancer 1)
Protein function Required for myelination.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in the brain and, more specifically, in oligodendrocytes (at protein level). Expressed in the prostate, and at lower levels in testis, intestine and colon. Overexpressed in most breast cancer cell lines and down-regula
Sequence
MGNQMSVPQRVEDQENEPEAETYQDNASALNGVPVVVSTHTVQHLEEVDLGISVKTDNVA
TSSPETTEISAVADANGKNLGKEAKPEAPAAKSRFFLMLSRPVPGRTGDQAADSSLGSVK
LDVSSNKAPANKDPSESWTLPVAAGPGQDTDKTPGHAPAQDKVLSAARDPTLLPPETGGA
GGEAPSKPKDSSFFDKFFKLDKGQEKVPGDSQQEAKRAEHQDKVDEVPGLSGQSDDVPAG
KDIVDGKEKEGQELGTADCSVPGDPEGLETAKDDSQAAAIAENNNSIMSFFKTLVSPNKA
ETKKDPEDTGAEKSPTTSADLKSDKANFTSQETQGAGKNSKGCNPSGHTQSVTTPEPAKE
GTKEKSGPTSLPLGKLFWKKSVKEDSVPTGAEENVVCESPVEIIKSKEVESALQTVDLNE
GDAAPEPTEAKLKREESKPRTSLMAFLRQMSVKGDGGITHSEEINGKDSSCQTSDSTEKT
ITPPEPEPTGAPQKGKEGSSKDKKSAAEMNKQKSNKQEAKEPAQCTEQATVDTNSLQNGD
KLQKRPEKRQQSLGGFFKGLGPKRMLDAQVQTDPVSIGPVGKSK
Sequence length 584
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Dermatitis Atopic dermatitis N/A N/A GWAS
Hyperuricemia Hyperuricemia N/A N/A GWAS
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 38104851
Breast Neoplasms Associate 12833450, 9671742
Glioma Associate 18474104
Neoplasms Associate 18474104, 23936147, 28069802, 30760648
Nephrolithiasis Calcium Oxalate Associate 35741705
Oncogene Addiction Associate 17233815
Pancreatic Neoplasms Associate 17233815
Prostatic Neoplasms Associate 37559353