Gene Gene information from NCBI Gene database.
Entrez ID 8537
Gene name Brain enriched myelin associated protein 1
Gene symbol BCAS1
Synonyms (NCBI Gene)
AIBC1NABC1PMES-2
Chromosome 20
Chromosome location 20q13.2
Summary This gene resides in a region at 20q13 which is amplified in a variety of tumor types and associated with more aggressive tumor phenotypes. Among the genes identified from this region, it was found to be highly expressed in three amplified breast cancer c
miRNA miRNA information provided by mirtarbase database.
385
miRTarBase ID miRNA Experiments Reference
MIRT608863 hsa-miR-3650 HITS-CLIP 24906430
MIRT608862 hsa-miR-933 HITS-CLIP 24906430
MIRT608861 hsa-miR-6867-5p HITS-CLIP 24906430
MIRT608860 hsa-miR-574-5p HITS-CLIP 24906430
MIRT441802 hsa-miR-3123 PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IEA
GO:0005737 Component Cytoplasm ISS
GO:0042552 Process Myelination IBA
GO:0042552 Process Myelination ISS
GO:0070062 Component Extracellular exosome HDA 23533145
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602968 974 ENSG00000064787
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75363
Protein name Breast carcinoma-amplified sequence 1 (Amplified and overexpressed in breast cancer) (Novel amplified in breast cancer 1)
Protein function Required for myelination.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in the brain and, more specifically, in oligodendrocytes (at protein level). Expressed in the prostate, and at lower levels in testis, intestine and colon. Overexpressed in most breast cancer cell lines and down-regula
Sequence
MGNQMSVPQRVEDQENEPEAETYQDNASALNGVPVVVSTHTVQHLEEVDLGISVKTDNVA
TSSPETTEISAVADANGKNLGKEAKPEAPAAKSRFFLMLSRPVPGRTGDQAADSSLGSVK
LDVSSNKAPANKDPSESWTLPVAAGPGQDTDKTPGHAPAQDKVLSAARDPTLLPPETGGA
GGEAPSKPKDSSFFDKFFKLDKGQEKVPGDSQQEAKRAEHQDKVDEVPGLSGQSDDVPAG
KDIVDGKEKEGQELGTADCSVPGDPEGLETAKDDSQAAAIAENNNSIMSFFKTLVSPNKA
ETKKDPEDTGAEKSPTTSADLKSDKANFTSQETQGAGKNSKGCNPSGHTQSVTTPEPAKE
GTKEKSGPTSLPLGKLFWKKSVKEDSVPTGAEENVVCESPVEIIKSKEVESALQTVDLNE
GDAAPEPTEAKLKREESKPRTSLMAFLRQMSVKGDGGITHSEEINGKDSSCQTSDSTEKT
ITPPEPEPTGAPQKGKEGSSKDKKSAAEMNKQKSNKQEAKEPAQCTEQATVDTNSLQNGD
KLQKRPEKRQQSLGGFFKGLGPKRMLDAQVQTDPVSIGPVGKSK
Sequence length 584
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Malignant tumor of esophagus Uncertain significance rs753600225 RCV005926910
Uterine corpus endometrial carcinoma Likely benign rs373877569 RCV005939074
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 38104851
Breast Neoplasms Associate 12833450, 9671742
Glioma Associate 18474104
Neoplasms Associate 18474104, 23936147, 28069802, 30760648
Nephrolithiasis Calcium Oxalate Associate 35741705
Oncogene Addiction Associate 17233815
Pancreatic Neoplasms Associate 17233815
Prostatic Neoplasms Associate 37559353