Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
85366
Gene name Gene Name - the full gene name approved by the HGNC.
Myosin light chain kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MYLK2
Synonyms (NCBI Gene) Gene synonyms aliases
KMLC, MLCK, MLCK2, skMLCK
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q11.21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a myosin light chain kinase, a calcium/calmodulin dependent enzyme, that is exclusively expressed in adult skeletal muscle. [provided by RefSeq, Jul 2008]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs41293104 T>A Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, missense variant
rs117502839 G>A,T Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign Coding sequence variant, missense variant
rs121908107 C>T Uncertain-significance, pathogenic Coding sequence variant, missense variant
rs121908108 C>A Likely-benign, pathogenic, benign Coding sequence variant, missense variant
rs147329431 G>A Conflicting-interpretations-of-pathogenicity Coding sequence variant, synonymous variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1168743 hsa-miR-122 CLIP-seq
MIRT1168744 hsa-miR-1343 CLIP-seq
MIRT1168745 hsa-miR-151-5p CLIP-seq
MIRT1168746 hsa-miR-151b CLIP-seq
MIRT1168747 hsa-miR-183 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0004672 Function Protein kinase activity IEA
GO:0004674 Function Protein serine/threonine kinase activity IEA
GO:0004683 Function Calcium/calmodulin-dependent protein kinase activity ISS
GO:0004687 Function Myosin light chain kinase activity IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606566 16243 ENSG00000101306
Protein
UniProt ID Q9H1R3
Protein name Myosin light chain kinase 2, skeletal/cardiac muscle (MLCK2) (EC 2.7.11.18)
Protein function Implicated in the level of global muscle contraction and cardiac function. Phosphorylates a specific serine in the N-terminus of a myosin light chain.
PDB 2LV6 , 3KF9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 285 540 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Heart and skeletal muscles. Increased expression in the apical tissue compared to the interventricular septal tissue.
Sequence
MATENGAVELGIQNPSTDKAPKGPTGERPLAAGKDPGPPDPKKAPDPPTLKKDAKAPASE
KGDGTLAQPSTSSQGPKGEGDRGGGPAEGSAGPPAALPQQTATPETSVKKPKAEQGASGS
QDPGKPRVGKKAAEGQAAARRGSPAFLHSPSCPAIISSSEKLLAKKPPSEASELTFEGVP
MTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGDTSRGIEFQAVPSEKSEV
GQALCLTAREEDCFQILDDCPPPPAPFPHRMVELRTGNVSSEFSMNSKEALGGGKFGAVC
TCMEKATGLKLAAKVIKKQTPKDKEMVLLEIEVMNQLNHRNLIQLYAAIETPHEIVLFME
YIEGGELFERIVDEDYHLTEVDTMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGH
LVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSMGVITYMLLSGLS
PFLGDDDTETLNNVLSGNWYFDEETFEAVSDEAKDFVSNLIVKDQRARMNAAQCLAHPWL

NNLAEKAKRCNRRLKSQILLKKYLMKRRWKKNFIAVSAANRFKKISSSGALMALGV
Sequence length 596
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Calcium signaling pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Apelin signaling pathway
Focal adhesion
Platelet activation
Regulation of actin cytoskeleton
Oxytocin signaling pathway
Gastric acid secretion
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
cardiomyopathy Cardiomyopathy N/A N/A ClinVar
Cardiomyopathy left ventricular noncompaction cardiomyopathy N/A N/A ClinVar
Dilated Cardiomyopathy Dilated cardiomyopathy 1KK N/A N/A ClinVar
Fabry disease fabry disease N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 34700051
Carcinoma Hepatocellular Associate 37309005
Cardiomyopathies Associate 33455984
Cardiomyopathy Dilated Associate 33455984
COVID 19 Associate 37309005
Histidinemia Associate 36876056
Inflammation Associate 32986378
Nasopharyngeal Carcinoma Associate 32986378
Nasopharyngitis Associate 32986378
Pancreatic Neoplasms Stimulate 20587030