CAMK1 (calcium/calmodulin dependent protein kinase I)

Gene

• Entrez ID: 8536
• Gene name: Calcium/calmodulin dependent protein kinase I
• Gene symbol: CAMK1
• Synonyms (NCBI Gene): CAMKI
• Chromosome: 3
• Chromosome location: 3p25.3
• Summary: Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT860019	hsa-miR-125a-3p	CLIP-seq
MIRT860020	hsa-miR-3127-5p	CLIP-seq
MIRT860021	hsa-miR-3150b-3p	CLIP-seq
MIRT860022	hsa-miR-3665	CLIP-seq
MIRT860023	hsa-miR-3919	CLIP-seq
MIRT860024	hsa-miR-4270	CLIP-seq
MIRT860025	hsa-miR-4436b-3p	CLIP-seq
MIRT860026	hsa-miR-4441	CLIP-seq
MIRT860027	hsa-miR-4536	CLIP-seq
MIRT860028	hsa-miR-4689	CLIP-seq
MIRT860029	hsa-miR-4710	CLIP-seq
MIRT860030	hsa-miR-4779	CLIP-seq
MIRT860031	hsa-miR-4783-3p	CLIP-seq
MIRT860032	hsa-miR-4784	CLIP-seq
MIRT860033	hsa-miR-671-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004683	Function	Calcium/calmodulin-dependent protein kinase activity	IBA
GO:0004683	Function	Calcium/calmodulin-dependent protein kinase activity	IEA
GO:0004683	Function	Calcium/calmodulin-dependent protein kinase activity	ISS
GO:0005515	Function	Protein binding	IPI	17442826, 32296183, 32707033, 32814053, 33961781
GO:0005516	Function	Calmodulin binding	IBA
GO:0005516	Function	Calmodulin binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IDA	11114197
GO:0006468	Process	Protein phosphorylation	TAS	9395448
GO:0006913	Process	Nucleocytoplasmic transport	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	7641687, 9395448
GO:0007399	Process	Nervous system development	IEA
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IDA	17442826
GO:0014069	Component	Postsynaptic density	IBA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0032091	Process	Negative regulation of protein binding	IDA	23867755
GO:0032880	Process	Regulation of protein localization	IBA
GO:0032880	Process	Regulation of protein localization	IDA	11114197
GO:0035556	Process	Intracellular signal transduction	IMP	23867755
GO:0043393	Process	Regulation of protein binding	IDA	11114197
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	23867755
GO:0046827	Process	Positive regulation of protein export from nucleus	IDA	23867755
GO:0046827	Process	Positive regulation of protein export from nucleus	IEA
GO:0050807	Process	Regulation of synapse organization	IBA
GO:0051147	Process	Regulation of muscle cell differentiation	IDA	11114197
GO:0051149	Process	Positive regulation of muscle cell differentiation	IMP	11081517
GO:0051835	Process	Positive regulation of synapse structural plasticity	IMP	18184567
GO:0060143	Process	Positive regulation of syncytium formation by plasma membrane fusion	IMP	23867755
GO:0060999	Process	Positive regulation of dendritic spine development	IMP	18184567
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IDA	17442826
GO:0106310	Function	Protein serine kinase activity	IEA

Other IDs

• MIM: 604998
• HGNC: 1459
• e!Ensembl: ENSG00000134072

Protein

• UniProt ID: Q14012
• Protein name: Calcium/calmodulin-dependent protein kinase type 1 (EC 2.7.11.17) (CaM kinase I) (CaM-KI) (CaM kinase I alpha) (CaMKI-alpha)
• Protein function: Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade and, upon calcium influx, regulates transcription activators activity, cell cycle, hormone production, cell differentiation, actin f
• PDB: 4FG7, 4FG8, 4FG9, 4FGB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	20 → 276	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Expressed in cells of the zona glomerulosa of the adrenal cortex. {ECO:0000269|PubMed:12193581, ECO:0000269|PubMed:17056143}.
• Sequence:

  MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKE
  GSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASR
  LIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACG
  TPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSP
  YWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK
  SKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCCCRDCCVEPGT
  ELSPTLPHQL

• Sequence length: 370

Pathways

KEGG:

Calcium signaling pathway
Oxytocin signaling pathway
Aldosterone synthesis and secretion
Glioma

Reactome:

Activation of RAC1 downstream of NMDARs