CST7 (cystatin F)

Gene

• Entrez ID: 8530
• Gene name: Cystatin F
• Gene symbol: CST7
• Synonyms (NCBI Gene): CMAP
• Chromosome: 20
• Chromosome location: 20p11.21
• Summary: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002020	Function	Protease binding	IPI	15752368, 22365146
GO:0002577	Process	Regulation of antigen processing and presentation	IDA	22365146
GO:0004866	Function	Endopeptidase inhibitor activity	TAS	9632704
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IBA
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IDA	15752368
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IEA
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	TAS	9733783
GO:0005515	Function	Protein binding	IPI	18256700
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	12423348, 15212960
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IBA
GO:0005764	Component	Lysosome	IDA	15752368, 18256700, 22365146
GO:0005764	Component	Lysosome	IEA
GO:0005768	Component	Endosome	IDA	15752368
GO:0005770	Component	Late endosome	IBA
GO:0005770	Component	Late endosome	IEA
GO:0005771	Component	Multivesicular body	IDA	22365146
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	15212960, 18256700
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA	18256700, 22365146
GO:0005794	Component	Golgi apparatus	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	9632704, 18256700
GO:0030414	Function	Peptidase inhibitor activity	IDA	18256700, 22365146
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	12423348, 15212960
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031643	Process	Positive regulation of myelination	IBA
GO:0031643	Process	Positive regulation of myelination	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	15212960, 15752368, 18256700
GO:1903979	Process	Negative regulation of microglial cell activation	IBA
GO:1903979	Process	Negative regulation of microglial cell activation	IEA
GO:1905146	Process	Lysosomal protein catabolic process	IDA	15752368, 22365146

Other IDs

• MIM: 603253
• HGNC: 2479
• e!Ensembl: ENSG00000077984

Protein

• UniProt ID: O76096
• Protein name: Cystatin-F (Cystatin-7) (Cystatin-like metastasis-associated protein) (CMAP) (Leukocystatin)
• Protein function: Inhibits papain and cathepsin L but with affinities lower than other cystatins. May play a role in immune regulation through inhibition of a unique target in the hematopoietic system.
• PDB: 2CH9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00031	Cystatin	37 → 133	Cystatin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Primarily expressed in peripheral blood cells and spleen.
• Sequence:

  MRAAGTLLAFCCLVLSTTGGPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKF
  NNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQ
  TLSCYSEVWVVPWLQHFEVPVLRCH

• Sequence length: 145

<