Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways
Entrez ID	85236
Gene name	H2B clustered histone 12
Gene symbol	H2BC12
Synonyms (NCBI Gene)	H2B/SH2BFAiiiH2BFTH2BKHIST1H2BK
Chromosome	6
Chromosome location	6p22.1
Summary	Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000786	Component	Nucleosome	IEA
GO:0002227	Process	Innate immune response in mucosa	IDA	12860195
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	31759698
GO:0005615	Component	Extracellular space	IDA	12860195
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	16319397
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0019731	Process	Antibacterial humoral response	IDA	12860195
GO:0030527	Function	Structural constituent of chromatin	IEA
GO:0031640	Process	Killing of cells of another organism	IDA	15019208
GO:0042742	Process	Defense response to bacterium	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	15019208
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	12860195
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12860195, 15019208

MIM	HGNC	e!Ensembl
615045	13954	ENSG00000197903

O60814

Protein name

Histone H2B type 1-K (H2B K) (HIRA-interacting protein 1)

Protein function

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair,

PDB

2CV5 , 6KE9 , 6L9H , 6LE9 , 6T79 , 6T7A , 6T7B , 6T7C , 6T7D , 6V92 , 6Y5D , 7BWD , 7DBP , 7JZV , 7PET , 7PEU , 7PEV , 7PEW , 7PEX , 7PEY , 7PEZ , 7PF0 , 7PF2 , 7PF3 , 7PF4 , 7PF5 , 7PF6 , 7PFA , 7PFC , 7PFD , 7PFE , 7PFF , 7PFT , 7PFU , 7PFV , 7PFW , 7PFX , 7V90 , 7V96 , 7V99 , 7V9C , 7V9J , 7V9K , 7V9S , 7VA4 , 7XCR , 7XCT , 7XD1 , 8GRQ , 8HQY , 8HR1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00125	Histone	2 → 102	Core histone H2A/H2B/H3/H4	Domain

Sequence

MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK

Sequence length

126

Interactions

View interactions

	KEGG		Reactome
	Neutrophil extracellular trap formation Alcoholism Viral carcinogenesis Systemic lupus erythematosus		Recognition and association of DNA glycosylase with site containing an affected purine Cleavage of the damaged purine Packaging Of Telomere Ends Formation of the beta-catenin:TCF transactivating complex PRC2 methylates histones and DNA Condensation of Prophase Chromosomes Oxidative Stress Induced Senescence Senescence-Associated Secretory Phenotype (SASP) DNA Damage/Telomere Stress Induced Senescence HDACs deacetylate histones HATs acetylate histones SIRT1 negatively regulates rRNA expression NoRC negatively regulates rRNA expression B-WICH complex positively regulates rRNA expression Transcriptional regulation by small RNAs Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 Ub-specific processing proteases Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks Nonhomologous End-Joining (NHEJ) Processing of DNA double-strand break ends Deposition of new CENPA-containing nucleosomes at the centromere G2/M DNA damage checkpoint RNA Polymerase I Promoter Opening RNA Polymerase I Promoter Escape E3 ubiquitin ligases ubiquitinate target proteins RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function Estrogen-dependent gene expression HCMV Early Events HCMV Late Events Amyloid fiber formation

H2BC12 (H2B clustered histone 12)