Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8520
Gene name Gene Name - the full gene name approved by the HGNC.
Histone acetyltransferase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HAT1
Synonyms (NCBI Gene) Gene synonyms aliases
KAT1
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a type B histone acetyltransferase (HAT) that is involved in the rapid acetylation of newly synthesized cytoplasmic histones, which are in turn imported into the nucleus for de novo deposition onto nascent DNA chains. H
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT028253 hsa-miR-32-5p Sequencing 20371350
MIRT498997 hsa-miR-3133 PAR-CLIP 20371350
MIRT498995 hsa-miR-186-5p PAR-CLIP 20371350
MIRT498994 hsa-miR-1243 PAR-CLIP 20371350
MIRT498993 hsa-miR-4463 PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000781 Component Chromosome, telomeric region HDA 19135898
GO:0000785 Component Chromatin IDA 14718166
GO:0004402 Function Histone acetyltransferase activity IEA
GO:0004402 Function Histone acetyltransferase activity TAS 9427644
GO:0005515 Function Protein binding IPI 19862764, 22190034, 22615379, 24981860, 25416956, 32296183, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603053 4821 ENSG00000128708
Protein
UniProt ID O14929
Protein name Histone acetyltransferase type B catalytic subunit (EC 2.3.1.48) (Histone acetyltransferase 1)
Protein function Histone acetyltransferase that plays a role in different biological processes including cell cycle progression, glucose metabolism, histone production or DNA damage repair (PubMed:20953179, PubMed:23653357, PubMed:31278053, PubMed:32081014). Coo
PDB 2P0W , 6VO5 , 9MJG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10394 Hat1_N 25 187 Histone acetyl transferase HAT1 N-terminus Domain
Sequence
MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLF
GDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFC
TNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQT
FLMWFIE
TASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQ
MLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCF
SREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLI
SPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
Sequence length 419
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Neutrophil extracellular trap formation
Alcoholism
  HATs acetylate histones
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Altitude Sickness Associate 32299499
Atherosclerosis Associate 31565149
Breast Neoplasms Associate 12841681
Carcinogenesis Associate 33372411
Carcinoma Hepatocellular Stimulate 33372411
Carcinoma Hepatocellular Associate 37763801
Cholangiocarcinoma Stimulate 33372411
Esophageal Neoplasms Associate 25120766
Esophageal Squamous Cell Carcinoma Associate 25120766
HIV Infections Associate 29615725