MMP23B (matrix metallopeptidase 23B)

Gene

• Entrez ID: 8510
• Gene name: Matrix metallopeptidase 23B
• Gene symbol: MMP23B
• Synonyms (NCBI Gene): MIFR, MIFR-1, MMP22, MMP23A
• Chromosome: 1
• Chromosome location: 1p36.33
• Summary: This gene (MMP23B) encodes a member of the matrix metalloproteinase (MMP) family, and it is part of a duplicated region of chromosome 1p36.3. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in no

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IDA	9988691
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	NAS	9740677
GO:0005615	Component	Extracellular space	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	NAS	9740677
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	NAS	9988691
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030574	Process	Collagen catabolic process	IBA
GO:0031012	Component	Extracellular matrix	HDA	28344315
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	NAS	9740677
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 603321
• HGNC: 7171
• e!Ensembl: ENSG00000189409

Protein

• UniProt ID: O75900
• Protein name: Matrix metalloproteinase-23 (MMP-23) (EC 3.4.24.-) (Femalysin) (MIFR-1) (Matrix metalloproteinase-21) (MMP-21) (Matrix metalloproteinase-22) (MMP-22) [Cleaved into: Matrix metalloproteinase-23, soluble form]
• Protein function: Protease. May regulate the surface expression of some potassium channels by retaining them in the endoplasmic reticulum (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00413	Peptidase_M10	87 → 254	Matrixin	Domain
  PF01549	ShK	254 → 289	ShK domain-like	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in ovary, testis and prostate. {ECO:0000269|PubMed:9988691}.
• Sequence:

  MGRGARVPSEAPGAGVERRWLGAALVALCLLPALVLLARLGAPAVPAWSAAQGDVAALGL
  SAVPPTRVPGPLAPRRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPRETRRALAAAFRM
  WSDVSPFSFREVAPEQPSDLRIGFYPINHTDCLVSALHHCFDGPTGELAHAFFPPHGGIH
  FDDSEYWVLGPTRYSWKKGVWLTDLVHVAAHEIGHALGLMHSQHGRALMHLNATLRGWKA
  LSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATT
  PPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIA
  NAVNEGTYTCVVRRQQRVLTTYSWRVRVRG

• Sequence length: 390