Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8504
Gene name Gene Name - the full gene name approved by the HGNC.
Peroxisomal biogenesis factor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PEX3
Synonyms (NCBI Gene) Gene synonyms aliases
PBD10A, PBD10B, TRG18
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q24.2
Summary Summary of gene provided in NCBI Entrez Gene.
The product of this gene is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The pero
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs41285015 A>G Uncertain-significance, conflicting-interpretations-of-pathogenicity Coding sequence variant, synonymous variant
rs147556993 C>A,T Pathogenic, benign Coding sequence variant, synonymous variant, stop gained
rs200807211 A>G Conflicting-interpretations-of-pathogenicity Intron variant
rs201179294 C>T Pathogenic Coding sequence variant, stop gained
rs267608193 T>G Pathogenic Intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT238882 hsa-miR-1183 PAR-CLIP 22100165
MIRT446022 hsa-miR-4301 PAR-CLIP 22100165
MIRT238876 hsa-miR-20b-3p PAR-CLIP 22100165
MIRT238900 hsa-miR-4703-3p PAR-CLIP 22100165
MIRT238889 hsa-miR-3156-3p PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 10704444, 11883941, 12096124, 16189514, 16280322, 18174172, 19715730, 21102411, 25416956, 25502805, 27107012, 28514442, 29997244, 31467278, 31515488, 32296183, 32814053, 33961781, 35271311, 37398436, 38225382
GO:0005654 Component Nucleoplasm IDA
GO:0005777 Component Peroxisome IDA 9922452
GO:0005777 Component Peroxisome IEA
GO:0005777 Component Peroxisome IMP 12924628
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603164 8858 ENSG00000034693
Protein
UniProt ID P56589
Protein name Peroxisomal biogenesis factor 3 (Peroxin-3) (Peroxisomal assembly protein PEX3)
Protein function Involved in peroxisome biosynthesis and integrity. Assembles membrane vesicles before the matrix proteins are translocated. As a docking factor for PEX19, is necessary for the import of peroxisomal membrane proteins in the peroxisomes. {ECO:0000
PDB 3AJB , 3MK4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04882 Peroxin-3 7 100 Peroxin-3 Family
PF04882 Peroxin-3 94 364 Peroxin-3 Family
Tissue specificity TISSUE SPECIFICITY: Found in all examined tissues.
Sequence
MLRSVWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAAEYIAQARRQYHFES
NQRTCNMTVLSMLPTLREALMQQLNSESLTALL
KNRPSNKLEIWEDLKIISFTRSTVAVY
STCMLVVLLRVQLNIIGGYIYLDNAAVGKNGTTILAPPDVQQQYLSSIQHLLGDGLTELI
TVIKQAVQKVLGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMP
DEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFR
PTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAAN
VYEA
FSTPQQLEK
Sequence length 373
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Peroxisome   ABC transporters in lipid homeostasis
Class I peroxisomal membrane protein import
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Zellweger Syndrome peroxisome biogenesis disorder 10b, peroxisome biogenesis disorder 10a (zellweger), peroxisome biogenesis disorder 1a (zellweger) rs201179294, rs752904598, rs267608193 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Ovarian Epithelial Associate 33676525
Infections Associate 34524914
Melanoma Associate 30622661, 37616051
Neoplasms Associate 37616051
Zellweger Syndrome Associate 10871277, 10958759, 34884833