Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
85019
Gene name Gene Name - the full gene name approved by the HGNC.
Solute carrier family 35 member D4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLC35D4
Synonyms (NCBI Gene) Gene synonyms aliases
C18orf45, TMEM241, hVVT
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q11.2
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT052533 hsa-let-7a-5p CLASH 23622248
MIRT618536 hsa-miR-7113-5p HITS-CLIP 23824327
MIRT618535 hsa-miR-1915-3p HITS-CLIP 23824327
MIRT618534 hsa-miR-6764-5p HITS-CLIP 23824327
MIRT618533 hsa-miR-129-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005458 Function GDP-mannose transmembrane transporter activity IBA
GO:0005462 Function UDP-N-acetylglucosamine transmembrane transporter activity IMP 37890669
GO:0005515 Function Protein binding IPI 32296183
GO:0005794 Component Golgi apparatus IBA
GO:0005794 Component Golgi apparatus IDA 37890669
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
615430 31723 ENSG00000134490
Protein
UniProt ID Q24JQ0
Protein name UDP-N-acetylglucosamine transporter TMEM241 (Solute carrier family 35 member D4) (Transmembrane protein 241)
Protein function Golgi-localized UDP-N-acetylglucosamine (UDP-GlcNAc) transporter that transports UDP-N-acetylglucosamine into Golgi lumen. Contributes to lysosomal targeting of NPC2, a key protein required for lysosomal cholesterol exiting, and that utilizes th
Family and domains
Sequence
MCVRRSLVGLTFCTCYLASYLTNKYVLSVLKFTYPTLFQGWQTLIGGLLLHVSWKLGWVE
INSSSRSHVLVWLPASVLFVGIIYAGSRALSRLAIPVFLTLHNVAEVIICGYQKCFQKEK
TSPAKICSALLLLAAAGCLPFNDSQFNPDGYFWAIIHLLCVGAYKILQKSQKPSALSDID
QQYLNYIFSVVLLAFASHPTGDLFSVLDFPFLYFYRFHGSCCASGFLGFFLMFSTVKLKN
LLAPGQCAAWIFFAKIITAGLSILLFDAILTSATTGCLLLGALGEALLVFSERKSS
Sequence length 296
Interactions View interactions
<