Gene Gene information from NCBI Gene database.
Entrez ID 85019
Gene name Solute carrier family 35 member D4
Gene symbol SLC35D4
Synonyms (NCBI Gene)
C18orf45TMEM241hVVT
Chromosome 18
Chromosome location 18q11.2
miRNA miRNA information provided by mirtarbase database.
117
miRTarBase ID miRNA Experiments Reference
MIRT052533 hsa-let-7a-5p CLASH 23622248
MIRT618536 hsa-miR-7113-5p HITS-CLIP 23824327
MIRT618535 hsa-miR-1915-3p HITS-CLIP 23824327
MIRT618534 hsa-miR-6764-5p HITS-CLIP 23824327
MIRT618533 hsa-miR-129-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
GO ID Ontology Definition Evidence Reference
GO:0005458 Function GDP-mannose transmembrane transporter activity IBA
GO:0005462 Function UDP-N-acetylglucosamine transmembrane transporter activity IMP 37890669
GO:0005515 Function Protein binding IPI 32296183
GO:0005794 Component Golgi apparatus IBA
GO:0005794 Component Golgi apparatus IDA 37890669
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
615430 31723 ENSG00000134490
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q24JQ0
Protein name UDP-N-acetylglucosamine transporter TMEM241 (Solute carrier family 35 member D4) (Transmembrane protein 241)
Protein function Golgi-localized UDP-N-acetylglucosamine (UDP-GlcNAc) transporter that transports UDP-N-acetylglucosamine into Golgi lumen. Contributes to lysosomal targeting of NPC2, a key protein required for lysosomal cholesterol exiting, and that utilizes th
Family and domains
Sequence
MCVRRSLVGLTFCTCYLASYLTNKYVLSVLKFTYPTLFQGWQTLIGGLLLHVSWKLGWVE
INSSSRSHVLVWLPASVLFVGIIYAGSRALSRLAIPVFLTLHNVAEVIICGYQKCFQKEK
TSPAKICSALLLLAAAGCLPFNDSQFNPDGYFWAIIHLLCVGAYKILQKSQKPSALSDID
QQYLNYIFSVVLLAFASHPTGDLFSVLDFPFLYFYRFHGSCCASGFLGFFLMFSTVKLKN
LLAPGQCAAWIFFAKIITAGLSILLFDAILTSATTGCLLLGALGEALLVFSERKSS
Sequence length 296
Interactions View interactions