Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	85004
Gene name	RAS like estrogen regulated growth inhibitor
Gene symbol	RERG
Synonyms (NCBI Gene)	-
Chromosome	12
Chromosome location	12p12.3
Summary	RERG, a member of the RAS superfamily of GTPases, inhibits cell proliferation and tumor formation (Finlin et al., 2001 [PubMed 11533059]).[supplied by OMIM, Mar 2009]

Show/Hide all (49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017557	hsa-miR-335-5p	Microarray	18185580
MIRT737262	hsa-miR-1288-3p	Luciferase reporter assayWestern blottingqRT-PCR	32654025
MIRT1300683	hsa-miR-1257	CLIP-seq
MIRT1300684	hsa-miR-1265	CLIP-seq
MIRT1300685	hsa-miR-1275	CLIP-seq
MIRT1300686	hsa-miR-153	CLIP-seq
MIRT1300687	hsa-miR-186	CLIP-seq
MIRT1300688	hsa-miR-2113	CLIP-seq
MIRT1300689	hsa-miR-214	CLIP-seq
MIRT1300690	hsa-miR-3074-3p	CLIP-seq
MIRT1300691	hsa-miR-3154	CLIP-seq
MIRT1300692	hsa-miR-3174	CLIP-seq
MIRT1300693	hsa-miR-3175	CLIP-seq
MIRT1300694	hsa-miR-3179	CLIP-seq
MIRT1300695	hsa-miR-3619-5p	CLIP-seq
MIRT1300696	hsa-miR-3620	CLIP-seq
MIRT1300697	hsa-miR-3657	CLIP-seq
MIRT1300698	hsa-miR-3659	CLIP-seq
MIRT1300699	hsa-miR-3945	CLIP-seq
MIRT1300700	hsa-miR-4271	CLIP-seq
MIRT1300701	hsa-miR-4279	CLIP-seq
MIRT1300702	hsa-miR-4307	CLIP-seq
MIRT1300703	hsa-miR-4424	CLIP-seq
MIRT1300704	hsa-miR-4427	CLIP-seq
MIRT1300705	hsa-miR-4452	CLIP-seq
MIRT1300706	hsa-miR-448	CLIP-seq
MIRT1300707	hsa-miR-4506	CLIP-seq
MIRT1300708	hsa-miR-4525	CLIP-seq
MIRT1300709	hsa-miR-4530	CLIP-seq
MIRT1300710	hsa-miR-4665-5p	CLIP-seq
MIRT1300711	hsa-miR-4669	CLIP-seq
MIRT1300712	hsa-miR-4680-3p	CLIP-seq
MIRT1300713	hsa-miR-4688	CLIP-seq
MIRT1300714	hsa-miR-4723-5p	CLIP-seq
MIRT1300715	hsa-miR-4725-3p	CLIP-seq
MIRT1300716	hsa-miR-4732-3p	CLIP-seq
MIRT1300717	hsa-miR-4762-3p	CLIP-seq
MIRT1300718	hsa-miR-4764-5p	CLIP-seq
MIRT1300719	hsa-miR-548u	CLIP-seq
MIRT1300720	hsa-miR-592	CLIP-seq
MIRT1300721	hsa-miR-599	CLIP-seq
MIRT1300722	hsa-miR-617	CLIP-seq
MIRT1300723	hsa-miR-625	CLIP-seq
MIRT1300724	hsa-miR-676	CLIP-seq
MIRT1300725	hsa-miR-761	CLIP-seq
MIRT1300705	hsa-miR-4452	CLIP-seq
MIRT2089390	hsa-miR-4795-3p	CLIP-seq
MIRT2089391	hsa-miR-660	CLIP-seq
MIRT2314236	hsa-miR-105	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001650	Component	Fibrillar center	IDA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	11533059
GO:0003924	Function	GTPase activity	IEA
GO:0003925	Function	G protein activity	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005634	Component	Nucleus	IDA	11533059
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	11533059
GO:0005886	Component	Plasma membrane	IBA
GO:0007264	Process	Small GTPase-mediated signal transduction	NAS	11533059
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	11533059
GO:0009725	Process	Response to hormone	IDA	11533059
GO:0016787	Function	Hydrolase activity	IEA
GO:0019003	Function	GDP binding	IBA
GO:0019003	Function	GDP binding	TAS	11533059
GO:0030308	Process	Negative regulation of cell growth	IDA	11533059
GO:0030331	Function	Nuclear estrogen receptor binding	NAS	11533059

MIM	HGNC	e!Ensembl
612664	15980	ENSG00000134533

Q96A58

Protein name

Ras-related and estrogen-regulated growth inhibitor (EC 3.6.5.2)

Protein function

Binds GDP/GTP and possesses intrinsic GTPase activity. Has higher affinity for GDP than for GTP. In cell lines overexpression leads to a reduction in the rate of proliferation, colony formation and in tumorigenic potential. {ECO:0000269|PubMed:1

PDB

2ATV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	8 → 169	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in heart, brain, placenta, lung, liver, skin, kidney and pancreas. Detected in estrogen receptor-positive breast-derived cell lines, but not in estrogen receptor-negative cell lines. Expression is decreased or lost in a signif

Sequence

MAKSAEVKLAIFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQATIDDEVVSMEILD
TAGQEDTIQREGHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNKA
DLDHSRQVSTEEGEKLATELACAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRR
SSTTHVKQAINKMLTKISS

Sequence length

199

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RAYNAUD DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	21826535	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	28257124	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	32654025	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	35682908	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	29961392	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Associate	21850178	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	28716111, 32324312	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	28257124, 31359505	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	34462486	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyps	Associate	28257124	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	33015704	★★★★★ ★☆☆☆☆ Found in Text Mining only

RERG (RAS like estrogen regulated growth inhibitor)