Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84991
Gene name Gene Name - the full gene name approved by the HGNC.
RNA binding motif protein 17
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RBM17
Synonyms (NCBI Gene) Gene synonyms aliases
SPF45
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10p15.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an RNA binding protein. The encoded protein is part of the spliceosome complex and functions in the second catalytic step of mRNA splicing. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chrom
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021290 hsa-miR-125a-5p Sequencing 20371350
MIRT025594 hsa-miR-10a-5p Sequencing 20371350
MIRT047772 hsa-miR-7-5p CLASH 23622248
MIRT047489 hsa-miR-10b-5p CLASH 23622248
MIRT1295086 hsa-miR-1290 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000380 Process Alternative mRNA splicing, via spliceosome IBA 21873635
GO:0000380 Process Alternative mRNA splicing, via spliceosome IMP 17589525
GO:0000398 Process MRNA splicing, via spliceosome IBA 21873635
GO:0000398 Process MRNA splicing, via spliceosome TAS
GO:0003723 Function RNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606935 16944 ENSG00000134453
Protein
UniProt ID Q96I25
Protein name Splicing factor 45 (45 kDa-splicing factor) (RNA-binding motif protein 17)
Protein function Splice factor that binds to the single-stranded 3'AG at the exon/intron border and promotes its utilization in the second catalytic step. Involved in the regulation of alternative splicing and the utilization of cryptic splice sites. Promotes th
PDB 2PE8 , 2PEH , 5LSO , 6HIP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01585 G-patch 235 279 G-patch domain Family
PF00076 RRM_1 323 383 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence
MSLYDDLGVETSDSKTEGWSKNFKLLQSQLQVKKAALTQAKSQRTKQSTVLAPVIDLKRG
GSSDDRQIVDTPPHVAAGLKDPVPSGFSAGEVLIPLADEYDPMFPNDYEKVVKRQREERQ
RQRELERQKEIEEREKRRKDRHEASGFARRPDPDSDEDEDYERERRKRSMGGAAIAPPTS
LVEKDKELPRDFPYEEDSRPRSQSSKAAIPPPVYEEQDRPRSPTGPSNSFLANMGGTVAH
KIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIV
GDATEKDASKKSDSNPLTEIL
KCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFE
RVESAIKAVVDLNGRYFGGRVVK
ACFYNLDKFRVLDLAEQV
Sequence length 401
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Spliceosome   mRNA Splicing - Major Pathway
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Spinocerebellar ataxia Ataxia, Spinocerebellar, Spinocerebellar Ataxia Type 1, Spinocerebellar Ataxia Type 2, Spinocerebellar Ataxia Type 4, Spinocerebellar Ataxia Type 5, Spinocerebellar Ataxia Type 6 (disorder), Spinocerebellar Ataxia Type 7 rs80356538, rs80356539, rs56144125, rs28937887, rs80356544, rs80356540, rs80356542, rs1941485201, rs121918306, rs151344520, rs151344519, rs151344521, rs151344523, rs151344512, rs193922926
View all (203 more)
18337722
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Asthma Asthma GWAS
Multiple Sclerosis Multiple Sclerosis GWAS
Stress Disorder Stress Disorder GWAS
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 15526362
Carcinoma Hepatocellular Stimulate 32497093
Leukemia Associate 35781533
Leukemia Myeloid Acute Associate 35781533
Mouth Neoplasms Associate 40243905
Neoplasms Associate 14578179, 32497093
Neoplasms Squamous Cell Associate 40243905
Ovarian Neoplasms Associate 14578179
Squamous Cell Carcinoma of Head and Neck Associate 40243905