Gene Gene information from NCBI Gene database.
Entrez ID 84991
Gene name RNA binding motif protein 17
Gene symbol RBM17
Synonyms (NCBI Gene)
SPF45
Chromosome 10
Chromosome location 10p15.1
Summary This gene encodes an RNA binding protein. The encoded protein is part of the spliceosome complex and functions in the second catalytic step of mRNA splicing. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chrom
miRNA miRNA information provided by mirtarbase database.
85
miRTarBase ID miRNA Experiments Reference
MIRT021290 hsa-miR-125a-5p Sequencing 20371350
MIRT025594 hsa-miR-10a-5p Sequencing 20371350
MIRT047772 hsa-miR-7-5p CLASH 23622248
MIRT047489 hsa-miR-10b-5p CLASH 23622248
MIRT1295086 hsa-miR-1290 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0000375 Process RNA splicing, via transesterification reactions IEA
GO:0000380 Process Alternative mRNA splicing, via spliceosome IBA
GO:0000380 Process Alternative mRNA splicing, via spliceosome IMP 17589525
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606935 16944 ENSG00000134453
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96I25
Protein name Splicing factor 45 (45 kDa-splicing factor) (RNA-binding motif protein 17)
Protein function Splice factor that binds to the single-stranded 3'AG at the exon/intron border and promotes its utilization in the second catalytic step. Involved in the regulation of alternative splicing and the utilization of cryptic splice sites. Promotes th
PDB 2PE8 , 2PEH , 5LSO , 6HIP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01585 G-patch 235 279 G-patch domain Family
PF00076 RRM_1 323 383 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence
MSLYDDLGVETSDSKTEGWSKNFKLLQSQLQVKKAALTQAKSQRTKQSTVLAPVIDLKRG
GSSDDRQIVDTPPHVAAGLKDPVPSGFSAGEVLIPLADEYDPMFPNDYEKVVKRQREERQ
RQRELERQKEIEEREKRRKDRHEASGFARRPDPDSDEDEDYERERRKRSMGGAAIAPPTS
LVEKDKELPRDFPYEEDSRPRSQSSKAAIPPPVYEEQDRPRSPTGPSNSFLANMGGTVAH
KIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIV
GDATEKDASKKSDSNPLTEIL
KCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFE
RVESAIKAVVDLNGRYFGGRVVK
ACFYNLDKFRVLDLAEQV
Sequence length 401
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Spliceosome   mRNA Splicing - Major Pathway