MIR22HG (MIR22 host gene)

Gene
Gene miRNA Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84981
Gene name Gene Name - the full gene name approved by the HGNC.
MIR22 host gene
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MIR22HG
Synonyms (NCBI Gene) Gene synonyms aliases
C17orf91
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p13.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Other IDs Protein Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT029499 hsa-miR-26b-5p Microarray 19088304
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
Gene miRNA Other IDs Protein Associated diseases
UniProt ID Q0VDD5
Protein name Putative uncharacterized protein encoded by MIR22HG
Family and domains
Sequence 
MGWEGPNSRVDDTFWASWRAFAQIGPARSGFRLETLAGLRSRRLKQPKAFCLRDVAP
Sequence length 57
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Triglyceride levels in non-type 2 diabetes N/A N/A GWAS
Show/Hide Text Mining Associations (26)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 31291201
Arthritis Rheumatoid Associate 32569434
Breast Neoplasms Associate 31613058, 32964046
Carcinoma Hepatocellular Associate 29669758, 30378276
Carcinoma Hepatocellular Inhibit 30670679, 30680848
Carcinoma Squamous Cell Associate 36333719
Endometrial Neoplasms Inhibit 30670679
Glioma Associate 34288803
Inflammation Associate 32233607
Lung Neoplasms Inhibit 29669758, 30670679