FRMD5 (FERM domain containing 5)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84978
Gene name Gene Name - the full gene name approved by the HGNC.
FERM domain containing 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FRMD5
Synonyms (NCBI Gene) Gene synonyms aliases
NEDEMA
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q15.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(42)
miRTarBase ID miRNA Experiments Reference
MIRT570696 hsa-miR-3936 PAR-CLIP 20371350
MIRT570695 hsa-miR-499b-5p PAR-CLIP 20371350
MIRT570694 hsa-miR-4305 PAR-CLIP 20371350
MIRT570693 hsa-miR-645 PAR-CLIP 20371350
MIRT570692 hsa-miR-517-5p PAR-CLIP 20371350
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
TP53 Unknown 19139068
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0005178 Function Integrin binding IDA 25448675
GO:0005515 Function Protein binding IPI 22846708, 25448675
GO:0005856 Component Cytoskeleton IBA
GO:0005912 Component Adherens junction IDA 22846708
GO:0005912 Component Adherens junction IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
616309 28214 ENSG00000171877
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID Q7Z6J6
Protein name FERM domain-containing protein 5
Protein function May be involved in regulation of cell migration (PubMed:22846708, PubMed:25448675). May regulate cell-matrix interactions via its interaction with ITGB5 and modifying ITGB5 cytoplasmic tail interactions such as with FERMT2 and TLN1. May regulate
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09379 FERM_N 21 → 84 FERM N-terminal domain Domain
PF00373 FERM_M 100 → 210 FERM central domain Domain
PF09380 FERM_C 214 → 302 FERM C-terminal PH-like domain Domain
PF08736 FA 309 → 352 FERM adjacent (FA) Family
Sequence 
MLSRLMSGSSRSLEREYSCTVRLLDDSEYTCTIQRDAKGQYLFDLLCHHLNLLEKDYFGI
RFVDPDKQRHWLEFTKSVVKQLRSQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRD
LYHGRLLCKTSDAALLAAYILQAEIGDYDSGKHPEGYSSKFQFFPKHSEKLERKIAEIHK
TELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHF
IKWNEVTKLKFEGKTFYLYVSQKEEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSS
QVRTVSSSNLFFKGSRFRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRSCPSITHGPR
LSSVPRTRRRAVHISIMEGLESLRDSAHSTPVRSTSHGDTFLPHVRSSRTDSNERVAVIA
DEAYSPADSVLPTPVAEHSLELMLLSRQINGATCSIEEEKESEASTPTATEVEALGGELR
ALCQGHSGPEEEQVNKFVLSVLRLLLVTMGLLFVLLLLLIILTESDLDIAFFRDIRQTPE
FEQFHYQYFCPLRRWFACKIRSVVSLLIDT
Sequence length 570
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Show/Hide Text Mining Associations (3)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Colorectal Neoplasms Associate 28117551
Neoplasms Associate 34201607
Thyroid Cancer Papillary Associate 34201607