Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	84969
Gene name Gene Name - the full gene name approved by the HGNC.	TOX high mobility group box family member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TOX2
Synonyms (NCBI Gene) Gene synonyms aliases	C20orf100, GCX-1, GCX1, dJ1108D11.2, dJ495O3.1
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q13.12

Show/Hide all(51)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017087	hsa-miR-335-5p	Microarray	18185580
MIRT1447854	hsa-miR-1185	CLIP-seq
MIRT1447855	hsa-miR-1224-5p	CLIP-seq
MIRT1447856	hsa-miR-1294	CLIP-seq
MIRT1447857	hsa-miR-2278	CLIP-seq
MIRT1447858	hsa-miR-3605-5p	CLIP-seq
MIRT1447859	hsa-miR-3679-5p	CLIP-seq
MIRT1447860	hsa-miR-3689a-3p	CLIP-seq
MIRT1447861	hsa-miR-3689c	CLIP-seq
MIRT1447862	hsa-miR-3915	CLIP-seq
MIRT1447863	hsa-miR-3928	CLIP-seq
MIRT1447864	hsa-miR-4299	CLIP-seq
MIRT1447865	hsa-miR-4316	CLIP-seq
MIRT1447866	hsa-miR-4428	CLIP-seq
MIRT1447867	hsa-miR-4456	CLIP-seq
MIRT1447868	hsa-miR-4519	CLIP-seq
MIRT1447869	hsa-miR-4677-3p	CLIP-seq
MIRT1447870	hsa-miR-4689	CLIP-seq
MIRT1447871	hsa-miR-4728-5p	CLIP-seq
MIRT1447872	hsa-miR-502-5p	CLIP-seq
MIRT1447873	hsa-miR-541	CLIP-seq
MIRT1447874	hsa-miR-548q	CLIP-seq
MIRT1447875	hsa-miR-654-5p	CLIP-seq
MIRT1447854	hsa-miR-1185	CLIP-seq
MIRT1447856	hsa-miR-1294	CLIP-seq
MIRT2396213	hsa-miR-1587	CLIP-seq
MIRT2396214	hsa-miR-3135b	CLIP-seq
MIRT1447858	hsa-miR-3605-5p	CLIP-seq
MIRT2396215	hsa-miR-3652	CLIP-seq
MIRT1447859	hsa-miR-3679-5p	CLIP-seq
MIRT2396216	hsa-miR-3918	CLIP-seq
MIRT2396217	hsa-miR-4261	CLIP-seq
MIRT1447865	hsa-miR-4316	CLIP-seq
MIRT2396218	hsa-miR-4430	CLIP-seq
MIRT1447867	hsa-miR-4456	CLIP-seq
MIRT2396219	hsa-miR-4487	CLIP-seq
MIRT2396220	hsa-miR-4492	CLIP-seq
MIRT2396221	hsa-miR-4496	CLIP-seq
MIRT2396222	hsa-miR-4498	CLIP-seq
MIRT2396223	hsa-miR-4633-3p	CLIP-seq
MIRT2396224	hsa-miR-4640-5p	CLIP-seq
MIRT2396225	hsa-miR-4656	CLIP-seq
MIRT2396226	hsa-miR-4675	CLIP-seq
MIRT1447869	hsa-miR-4677-3p	CLIP-seq
MIRT2396227	hsa-miR-4685-5p	CLIP-seq
MIRT2396228	hsa-miR-4726-5p	CLIP-seq
MIRT2396229	hsa-miR-4731-5p	CLIP-seq
MIRT2396230	hsa-miR-4741	CLIP-seq
MIRT1447872	hsa-miR-502-5p	CLIP-seq
MIRT2396231	hsa-miR-548b-3p	CLIP-seq
MIRT2396232	hsa-miR-762	CLIP-seq

Show/Hide all(6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003713	Function	Transcription coactivator activity	IDA	25352127
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0031490	Function	Chromatin DNA binding	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	25352127

MIM	HGNC	e!Ensembl
611163	16095	ENSG00000124191

Protein

UniProt ID

Q96NM4

Protein name

TOX high mobility group box family member 2 (Granulosa cell HMG box protein 1) (GCX-1)

Protein function

Putative transcriptional activator involved in the hypothalamo-pituitary-gonadal system.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00505	HMG_box	255 → 304	HMG (high mobility group) box	Domain

Sequence

MQQTRTEAVAGAFSRCLGFCGMRLGLLLLARHWCIAGVFPQKFDGDSAYVGMSDGNPELL
STSQTYNGQSENNEDYEIPPITPPNLPEPSLLHLGDHEASYHSLCHGLTPNGLLPAYSYQ
AMDLPAIMVSNMLAQDSHLLSGQLPTIQEMVHSEVAAYDSGRPGPLLGRPAMLASHMSAL
SQSQLISQMGIRSSIAHSSPSPPGSKSATPSPSSSTQEEESEVHFKISGEKRPSADPGKK
AKNPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPSATFGDVSKIVASMWDSLGEEQ
KQSSPDQGETKSTQANPPAKMLPPKQPMYAMPGLASFLTPSDLQAFRSGASPASLARTLG
SKSLLPGLSASPPPPPSFPLSPTLHQQLSLPPHAQGALLSPPVSMSPAPQPPVLPTPMAL
QVQLAMSPSPPGPQDFPHISEFPSSSGSCSPGPSNPTSSGDWDSSYPSGECGISTCSLLP
RDKSLYLT

Sequence length

488

Interactions

View interactions

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Colonic neoplasms	Malignant tumor of colon	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	31089142, 30510241
Colorectal cancer	Colorectal Carcinoma, Adenocarcinoma of large intestine	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)	31089142, 30510241
Colorectal neoplasms	Colorectal Neoplasms, Malignant neoplasm of large intestine	rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049 View all (1682 more)	31089142, 30510241

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Evidence	References	Source
Unknown
Chronic obstructive pulmonary disease	Chronic Obstructive Airway Disease		26634245	ClinVar
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.		GWAS, CBGDA
Multiple Sclerosis	Multiple Sclerosis			GWAS
Diabetes	Diabetes			GWAS
Sarcoidosis	Sarcoidosis			GWAS

Show/Hide Text Mining Associations (16)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	22496870
Carcinogenesis	Associate	22496870
Colorectal Neoplasms	Stimulate	32393998
GATA2 Deficiency	Associate	37032358
Hereditary Breast and Ovarian Cancer Syndrome	Associate	22496870
Hodgkin Disease	Associate	35111387
Inflammation	Associate	22496870
Leukemia Lymphocytic Chronic B Cell	Associate	34362918
Lung Diseases	Associate	22496870
Lung Neoplasms	Inhibit	22496870
Lung Neoplasms	Associate	29796116
Lymphoma T Cell	Associate	36417130
Neoplasm Metastasis	Associate	37032358
Neoplasms	Associate	22496870, 32393998, 34362918, 35111387, 36417130, 37467321
Pressure Ulcer	Associate	24473254
Prostatic Neoplasms	Associate	37279148

TOX2 (TOX high mobility group box family member 2)