AJUBA (ajuba LIM protein)

Gene

• Entrez ID: 84962
• Gene name: Ajuba LIM protein
• Gene symbol: AJUBA
• Synonyms (NCBI Gene): JUB
• Chromosome: 14
• Chromosome location: 14q11.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021880	hsa-miR-128-3p	Microarray	17612493
MIRT025601	hsa-miR-10a-5p	Sequencing	20371350
MIRT042680	hsa-miR-196b-5p	CLASH	23622248
MIRT736613	hsa-miR-1184	Western blotting, Immunoprecipitaion (IP), qRT-PCR	32681581
MIRT756224	hsa-miR-21-5p	Luciferase reporter assay, Western blotting, qRT-PCR	36457985

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000932	Component	P-body	IBA
GO:0000932	Component	P-body	IDA	20616046
GO:0000932	Component	P-body	IEA
GO:0001666	Process	Response to hypoxia	IBA
GO:0001666	Process	Response to hypoxia	IDA	22286099
GO:0001666	Process	Response to hypoxia	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IDA	18805794
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0005515	Function	Protein binding	IPI	15778465, 16413547, 18331720, 18805794, 20303269, 20616046, 22286099, 25314079, 32296183, 33961781, 37219487
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	18805794
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005911	Component	Cell-cell junction	IDA	12417594
GO:0005911	Component	Cell-cell junction	IEA
GO:0005912	Component	Adherens junction	IBA
GO:0005925	Component	Focal adhesion	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0007010	Process	Cytoskeleton organization	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0009891	Process	Positive regulation of biosynthetic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0030032	Process	Lamellipodium assembly	IEA
GO:0030295	Function	Protein kinase activator activity	IEA
GO:0030334	Process	Regulation of cell migration	IEA
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	15870274
GO:0035195	Process	MiRNA-mediated post-transcriptional gene silencing	IMP	20616046
GO:0035278	Process	MiRNA-mediated gene silencing by inhibition of translation	IEA
GO:0035278	Process	MiRNA-mediated gene silencing by inhibition of translation	IMP	20616046
GO:0035313	Process	Wound healing, spreading of epidermal cells	IEA
GO:0035331	Process	Negative regulation of hippo signaling	IBA
GO:0035331	Process	Negative regulation of hippo signaling	IDA	20303269
GO:0035331	Process	Negative regulation of hippo signaling	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0045294	Function	Alpha-catenin binding	IDA	12417594
GO:0045294	Function	Alpha-catenin binding	IEA
GO:0046474	Process	Glycerophospholipid biosynthetic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048041	Process	Focal adhesion assembly	IEA
GO:0051015	Function	Actin filament binding	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:1900037	Process	Regulation of cellular response to hypoxia	IDA	22286099

Other IDs

• MIM: 609066
• HGNC: 20250
• e!Ensembl: ENSG00000129474

Protein

• UniProt ID: Q96IF1
• Protein name: LIM domain-containing protein ajuba
• Protein function: Adapter or scaffold protein which participates in the assembly of numerous protein complexes and is involved in several cellular processes such as cell fate determination, cytoskeletal organization, repression of gene transcription, mitosis, cel
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00412	LIM	338 → 394	LIM domain	Domain
  PF00412	LIM	403 → 459	LIM domain	Domain
  PF00412	LIM	463 → 528	LIM domain	Domain

• Sequence:

  MERLGEKASRLLEKFGRRKGESSRSGSDGTPGPGKGRLSGLGGPRKSGPRGATGGPGDEP
  LEPAREQGSLDAERNQRGSFEAPRYEGSFPAGPPPTRALPLPQSLPPDFRLEPTAPALSP
  RSSFASSSASDASKPSSPRGSLLLDGAGAGGAGGSRPCSNRTSGISMGYDQRHGSPLPAG
  PCLFGPPLAGAPAGYSPGGVPSAYPELHAALDRLYAQRPAGFGCQESRHSYPPALGSPGA
  LAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDELTALLRLTVGTGGREAGARGE
  PSGIEPSGLEEPPGPFVPEAARARMREPEAREDYFGTCIKCNKGIYGQSNACQALDSLYH
  TQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLILEKILQAMGK
  SYHPGCFRCIVCNKCLDGIPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGCEDIV
  RVISMDRDYHFECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLNARQPPANYI

• Sequence length: 538

Pathways

KEGG:

Hippo signaling pathway
Hippo signaling pathway - multiple species

Reactome:

Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Regulation of PLK1 Activity at G2/M Transition