Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	84962
Gene name Gene Name - the full gene name approved by the HGNC.	Ajuba LIM protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	AJUBA
Synonyms (NCBI Gene) Gene synonyms aliases	JUB
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q11.2

Show/Hide all(5)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021880	hsa-miR-128-3p	Microarray	17612493
MIRT025601	hsa-miR-10a-5p	Sequencing	20371350
MIRT042680	hsa-miR-196b-5p	CLASH	23622248
MIRT736613	hsa-miR-1184	Western blotting, Immunoprecipitaion (IP), qRT-PCR	32681581
MIRT756224	hsa-miR-21-5p	Luciferase reporter assay, Western blotting, qRT-PCR	36457985

Show/Hide all(47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000932	Component	P-body	IBA	21873635
GO:0000932	Component	P-body	IDA	20616046
GO:0001666	Process	Response to hypoxia	IBA	21873635
GO:0001666	Process	Response to hypoxia	IDA	22286099
GO:0003682	Function	Chromatin binding	IEA
GO:0003714	Function	Transcription corepressor activity	IBA	21873635
GO:0003714	Function	Transcription corepressor activity	IDA	18805794
GO:0005515	Function	Protein binding	IPI	15778465, 16413547, 18331720, 18805794, 20303269, 20616046, 22286099, 25314079, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	18805794
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IBA	21873635
GO:0005794	Component	Golgi apparatus	IDA
GO:0005815	Component	Microtubule organizing center	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005911	Component	Cell-cell junction	IDA	12417594
GO:0005912	Component	Adherens junction	IBA	21873635
GO:0005925	Component	Focal adhesion	IEA
GO:0006355	Process	Regulation of transcription, DNA-templated	IBA	21873635
GO:0007010	Process	Cytoskeleton organization	IBA	21873635
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0030032	Process	Lamellipodium assembly	IEA
GO:0030334	Process	Regulation of cell migration	IEA
GO:0031328	Process	Positive regulation of cellular biosynthetic process	IEA
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	15870274
GO:0033673	Process	Negative regulation of kinase activity	IEA
GO:0034613	Process	Cellular protein localization	IEA
GO:0035195	Process	Gene silencing by miRNA	IMP	20616046
GO:0035313	Process	Wound healing, spreading of epidermal cells	IEA
GO:0035331	Process	Negative regulation of hippo signaling	IBA	21873635
GO:0035331	Process	Negative regulation of hippo signaling	IDA	20303269
GO:0043087	Process	Regulation of GTPase activity	IEA
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA
GO:0043406	Process	Positive regulation of MAP kinase activity	IEA
GO:0045294	Function	Alpha-catenin binding	IDA	12417594
GO:0046474	Process	Glycerophospholipid biosynthetic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048041	Process	Focal adhesion assembly	IEA
GO:0051015	Function	Actin filament binding	IEA
GO:1900037	Process	Regulation of cellular response to hypoxia	IDA	22286099
GO:2000637	Process	Positive regulation of gene silencing by miRNA	IBA	21873635
GO:2000637	Process	Positive regulation of gene silencing by miRNA	IMP	20616046

MIM	HGNC	e!Ensembl
609066	20250	ENSG00000129474

Protein

UniProt ID

Q96IF1

Protein name

LIM domain-containing protein ajuba

Protein function

Adapter or scaffold protein which participates in the assembly of numerous protein complexes and is involved in several cellular processes such as cell fate determination, cytoskeletal organization, repression of gene transcription, mitosis, cel

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00412	LIM	338 → 394	LIM domain	Domain
PF00412	LIM	403 → 459	LIM domain	Domain
PF00412	LIM	463 → 528	LIM domain	Domain

Sequence

MERLGEKASRLLEKFGRRKGESSRSGSDGTPGPGKGRLSGLGGPRKSGPRGATGGPGDEP
LEPAREQGSLDAERNQRGSFEAPRYEGSFPAGPPPTRALPLPQSLPPDFRLEPTAPALSP
RSSFASSSASDASKPSSPRGSLLLDGAGAGGAGGSRPCSNRTSGISMGYDQRHGSPLPAG
PCLFGPPLAGAPAGYSPGGVPSAYPELHAALDRLYAQRPAGFGCQESRHSYPPALGSPGA
LAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDELTALLRLTVGTGGREAGARGE
PSGIEPSGLEEPPGPFVPEAARARMREPEAREDYFGTCIKCNKGIYGQSNACQALDSLYH
TQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLILEKILQAMGK
SYHPGCFRCIVCNKCLDGIPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGCEDIV
RVISMDRDYHFECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLNARQPPANYI

Sequence length

538

Interactions

View interactions

	KEGG		Reactome
	Hippo signaling pathway Hippo signaling pathway - multiple species		Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha Regulation of PLK1 Activity at G2/M Transition

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Esophagus neoplasm	Squamous cell carcinoma of esophagus	rs28934578, rs121918714, rs1567556006, rs1575166666	25151357

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text Mining
Anophthalmia with pulmonary hypoplasia	Associate	31101117
Breast Neoplasms	Associate	30597111
Breast Neoplasms	Stimulate	35178446
Colorectal Neoplasms	Stimulate	24673742
Colorectal Neoplasms	Associate	34173718, 36267311, 36931700
COVID 19	Associate	37018908
Esophageal Neoplasms	Associate	29127303
Esophageal Squamous Cell Carcinoma	Associate	25839328
Lymphatic Metastasis	Stimulate	35178446
Neoplasm Metastasis	Associate	24673742, 34173718
Neoplasms	Associate	25303977, 26873401, 29596435, 35178446
Neoplasms	Inhibit	33430890
Pancreatic Neoplasms	Associate	29596435, 31101117
Small Cell Lung Carcinoma	Associate	23714854, 27627196
Squamous Cell Carcinoma of Head and Neck	Associate	29053175

AJUBA (ajuba LIM protein)