Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84959
Gene name Gene Name - the full gene name approved by the HGNC.
Ubiquitin associated and SH3 domain containing B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
UBASH3B
Synonyms (NCBI Gene) Gene synonyms aliases
STS-1, STS1, TULA-2, TULA2, p70
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q24.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that contains a ubiquitin associated domain at the N-terminus, an SH3 domain, and a C-terminal domain with similarities to the catalytic motif of phosphoglycerate mutase. The encoded protein was found to inhibit endocytosis of
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024758 hsa-miR-215-5p Microarray 19074876
MIRT026942 hsa-miR-192-5p Microarray 19074876
MIRT053353 hsa-miR-200a-3p Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 23784775
MIRT492023 hsa-miR-4797-5p PAR-CLIP 23592263
MIRT492022 hsa-miR-486-5p PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004721 Function Phosphoprotein phosphatase activity IEA
GO:0004725 Function Protein tyrosine phosphatase activity IBA
GO:0004725 Function Protein tyrosine phosphatase activity IEA
GO:0005515 Function Protein binding IPI 17599067, 20585042, 24722188, 25416956, 28514442, 31515488, 32296183, 33961781, 36179048
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609201 29884 ENSG00000154127
Protein
UniProt ID Q8TF42
Protein name Ubiquitin-associated and SH3 domain-containing protein B (EC 3.1.3.48) (Cbl-interacting protein p70) (Suppressor of T-cell receptor signaling 1) (STS-1) (T-cell ubiquitin ligand 2) (TULA-2) (Tyrosine-protein phosphatase STS1/TULA2)
Protein function Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors and EGFR, on the cell surface. Exhibits tyrosine phosphatase activity t
PDB 2CPW , 2E5K , 5VR6 , 5W5G , 8U5M , 8U7E
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00627 UBA 39 73 UBA/TS-N domain Domain
PF14604 SH3_9 261 315 Variant SH3 domain Domain
PF00300 His_Phos_1 426 610 Histidine phosphatase superfamily (branch 1) Domain
Sequence
MAQYGHPSPLGMAAREELYSKVTPRRNRQQRPGTIKHGSALDVLLSMGFPRARAQKALAS
TGGRSVQAACDWL
FSHVGDPFLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQICGKNKA
HNIFPHITLCQFFMCEDSKVDALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKED
SAEVLKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQASHLPTLEKLAQNIDVKLGC
DWVATIFSRDIRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTS
LTTGCSGLLPENYIT
KADECSTWIFHGSYSILNTSSSNSLTFGDGVLERRPYEDQGLGET
TPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLN
MPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHN
ILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKL
VVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQ
MVRKIPYLGF
CSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE
Sequence length 649
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Hypertension Hypertension (confirmatory factor analysis Factor 12) N/A N/A GWAS
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Behcet Syndrome Associate 19442274
Hemorrhage Associate 36453946
Infectious Mononucleosis Associate 2295000
Leukemia Associate 33556471
Lymphoma Associate 11337356
Nijmegen Breakage Syndrome Associate 25119968, 25214013, 25485873
Pancreatic Neoplasms Associate 40486509
Pneumococcal Infections Associate 26956584
Progeroid syndrome neonatal Associate 25214013
Pulmonary Disease Chronic Obstructive Associate 37678858