SYTL1 (synaptotagmin like 1)

Gene

• Entrez ID: 84958
• Gene name: Synaptotagmin like 1
• Gene symbol: SYTL1
• Synonyms (NCBI Gene): JFC1, SLP1
• Chromosome: 1
• Chromosome location: 1p36.11

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018489	hsa-miR-335-5p	Microarray	18185580
MIRT1407806	hsa-miR-125a-5p	CLIP-seq
MIRT1407807	hsa-miR-125b	CLIP-seq
MIRT1407808	hsa-miR-1273f	CLIP-seq
MIRT1407809	hsa-miR-1291	CLIP-seq
MIRT1407810	hsa-miR-143	CLIP-seq
MIRT1407811	hsa-miR-198	CLIP-seq
MIRT1407812	hsa-miR-4319	CLIP-seq
MIRT1407813	hsa-miR-4324	CLIP-seq
MIRT1407814	hsa-miR-4436b-3p	CLIP-seq
MIRT1407815	hsa-miR-4662a-5p	CLIP-seq
MIRT1407816	hsa-miR-4708-5p	CLIP-seq
MIRT1407817	hsa-miR-4770	CLIP-seq
MIRT1407818	hsa-miR-615-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	18266782, 32296183, 33961781
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	18266782
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006887	Process	Exocytosis	IBA
GO:0006887	Process	Exocytosis	IDA	18266782
GO:0006887	Process	Exocytosis	IEA
GO:0016020	Component	Membrane	IEA
GO:0031267	Function	Small GTPase binding	IEA
GO:0031528	Component	Microvillus membrane	TAS
GO:0042043	Function	Neurexin family protein binding	IBA
GO:0042043	Function	Neurexin family protein binding	ISS
GO:0042470	Component	Melanosome	ISS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070382	Component	Exocytic vesicle	IBA

Other IDs

• MIM: 608042
• HGNC: 15584
• e!Ensembl: ENSG00000142765

Protein

• UniProt ID: Q8IYJ3
• Protein name: Synaptotagmin-like protein 1 (Exophilin-7) (Protein JFC1)
• Protein function: May play a role in vesicle trafficking (By similarity). Binds phosphatidylinositol 3,4,5-trisphosphate. Acts as a RAB27A effector protein and may play a role in cytotoxic granule exocytosis in lymphocytes (By similarity). {ECO:0000250, ECO:00002
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00168	C2	281 → 385	C2 domain	Domain
  PF00168	C2	422 → 530	C2 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in bone marrow and lymphoid tissues. Detected at lower levels in cerebellum, occipital lobe, prostate, stomach, kidney, appendix, lung and trachea. Expressed in cytotoxic T-lymphocytes (CTL). {ECO:0000269|PubMed:112788
• Sequence:

  MPQRGHPSQEGLWALPSLPMAHGPKPETEGLLDLSFLTEEEQEAIAGVLQRDARLRQLEE
  GRVSKLRASVADPGQLKILTGDWFQEARSQRHHNAHFGSDLVRASMRRKKSTRGDQAPGH
  DREAEAAVKEKEEGPEPRLTIDEAPQERLRETEGPDFPSPSVPLKASDPEEASQAQEDPG
  QGDQQVCAEEADPELEPASGGEQEPRPQQAQTKAASQILENGEEAPGPDPSLDRMLSSSS
  SVSSLNSSTLSGSQMSLSGDAEAVQVRGSVHFALHYEPGAAELRVHVIQCQGLAAARRRR
  SDPYVKSYLLPDKQSKRKTAVKKRNLNPVFNETLRYSVPQAELQGRVLSLSVWHRESLGR
  NIFLGEVEVPLDTWDWGSEPTWLPLQPRVPPSPDDLPSRGLLALSLKYVPAGSEGAGLPP
  SGELHFWVKEARDLLPLRAGSLDTYVQCFVLPDDSQASRQRTRVVRRSLSPVFNHTMVYD
  GFGPADLRQACAELSLWDHGALANRQLGGTRLSLGTGSSYGLQVPWMDSTPEEKQLWQAL
  LEQPCEWVDGLLPLRTNLAPRT

• Sequence length: 562

Pathways

Reactome:

TBC/RABGAPs

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Endometrial Neoplasms	Associate	36653850	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	36653850	★☆☆☆☆ Found in Text Mining only
Non Muscle Invasive Bladder Neoplasms	Associate	22724020	★☆☆☆☆ Found in Text Mining only
Prostatitis	Associate	12137562, 18413239	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	22724020	★☆☆☆☆ Found in Text Mining only