Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84947
Gene name Gene Name - the full gene name approved by the HGNC.
Serine active site containing 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SERAC1
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q25.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a phosphatidylglycerol remodeling protein found at the interface of mitochondria and endoplasmic reticula, where it mediates phospholipid exchange. The encoded protein plays a major role in mitochondrial function and in
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs139301835 G>A,C,T Likely-pathogenic, uncertain-significance Non coding transcript variant, synonymous variant, 5 prime UTR variant, genic upstream transcript variant, stop gained, missense variant, coding sequence variant
rs199632531 G>A Pathogenic Coding sequence variant, stop gained, non coding transcript variant
rs201941476 C>G Likely-pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs387907236 G>A Pathogenic Non coding transcript variant, coding sequence variant, stop gained
rs529232938 G>A Pathogenic Coding sequence variant, 5 prime UTR variant, non coding transcript variant, stop gained
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019450 hsa-miR-148b-3p Microarray 17612493
MIRT021468 hsa-miR-9-5p Microarray 17612493
MIRT023363 hsa-miR-122-5p Microarray 17612493
MIRT024800 hsa-miR-215-5p Microarray 19074876
MIRT026696 hsa-miR-192-5p Microarray 19074876
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003674 Function Molecular_function ND
GO:0005739 Component Mitochondrion IDA 22683713
GO:0005783 Component Endoplasmic reticulum IDA 22683713
GO:0008654 Process Phospholipid biosynthetic process IEA
GO:0016021 Component Integral component of membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614725 21061 ENSG00000122335
Protein
UniProt ID Q96JX3
Protein name Protein SERAC1 (Serine active site-containing protein 1)
Protein function Facilitates the transport of serine from the cytosol to the mitochondria by interacting with and stabilizing Sideroflexin-1 (SFXN1), a mitochondrial serine transporter, playing a fundamental role in the one-carbon cycle responsible for the synth
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with predominant expression in skeletal muscle and brain (PubMed:22683713, PubMed:35235340). In the brain, highest levels are found in the frontal and occipital cortices, cerebellum and hippocampus (PubMed:22683713).
Sequence
MSLAAYCVICCRRIGTSTSPPKSGTHWRDIRNIIKFTGSLILGGSLFLTYEVLALKKAVT
LDTQVVEREKMKSYIYVHTVSLDKGENHGIAWQARKELHKAVRKVLATSAKILRNPFADP
FSTVDIEDHECAVWLLLRKSKSDDKTTRLEAVREMSETHHWHDYQYRIIAQACDPKTLIG
LARSEESDLRFFLLPPPLPSLKEDSSTEEELRQLLASLPQTELDECIQYFTSLALSESSQ
SLAAQKGGLWCFGGNGLPYAESFGEVPSATVEMFCLEAIVKHSEISTHCDKIEANGGLQL
LQRLYRLHKDCPKVQRNIMRVIGNMALNEHLHSSIVRSGWVSIMAEAMKSPHIMESSHAA
RILANLDRETVQEKYQDGVYVLHPQYRTSQPIKADVLFIHGLMGAAFKTWRQQDSEQAVI
EKPMEDEDRYTTCWPKTWLAKDCPALRIISVEYDTSLSDWRARCPMERKSIAFRSNELLR
KLRAAGVGDRPVVWISHSMGGLLVKKMLLEASTKPEMSTVINNTRGIIFYSVPHHGSRLA
EYSVNIRYLLFPSLEVKELSKDSPALKTLQDDFLEFAKDKNFQVLNFVETLPTYIGSMIK
LHVVPVESADLGIGDLIPVDVNHLNICKPKKKDAFLYQRTLQFIREALAKDLEN
Sequence length 654
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
3-methylglutaconic aciduria with sensorineural deafness, encephalopathy and leigh-like syndrome 3-methylglutaconic aciduria type IV with sensorineural deafness, encephalopathy and Leigh-like syndrome rs387907236, rs772296795, rs1199625391, rs529232938, rs797045105, rs767780913, rs780275814, rs199632531, rs886041750, rs1554260851, rs761964407, rs1131690799, rs1220930025, rs758745099, rs1554265452
View all (7 more)
27604308, 27186703, 16527507
Deafness Prelingual Deafness, Deafness, Acquired, Deaf Mutism rs267607135, rs387906219, rs387906220, rs387906221, rs387906222, rs606231120, rs267606855, rs121918370, rs137853185, rs137853186, rs137853187, rs137853188, rs587776522, rs587776523, rs200781822
View all (1019 more)
22683713
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Developmental regression Developmental regression rs1224421127
Unknown
Disease term Disease name Evidence References Source
3-Methylglutaconic Aciduria With Sensorineural Deafness, Encephalopathy And Leigh-Like Syndrome 3-methylglutaconic aciduria with deafness, encephalopathy, and Leigh-like syndrome GenCC
Leigh Syndrome Leigh syndrome GenCC
Associations from Text Mining
Disease Name Relationship Type References
3 Methylglutaconic Aciduria Associate 25642805, 27485409, 29205472, 31251474, 34751152, 39592976
Anodontia Associate 39592976
Brain Diseases Associate 29205472, 34751152
Breast Neoplasms Associate 18460216, 35589867
Cholestasis Associate 25016221
Dystonia Associate 29205472
Focal cortical dysplasia of Taylor Associate 40282380
GSD IV Neuromuscular Form Fatal Perinatal Associate 25016221
Histiocytosis with joint contractures and sensorineural deafness Associate 39592976
Hypoglycemia Associate 29205472