Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84942
Gene name Gene Name - the full gene name approved by the HGNC.
WD repeat domain 73
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
WDR73
Synonyms (NCBI Gene) Gene synonyms aliases
GAMOS, GAMOS1, HSPC264
Disease Acronyms (UniProt) Disease acronyms from UniProt database
GAMOS1
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q25.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is thought to contain multiple WD40 repeats. WD40 repeats are motifs that contain 40-60 amino acids, and usually end with Trp-Asp (WD). This protein is found in the cytoplasm during interphase, but accumulates at the spind
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs201294090 C>T Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant, non coding transcript variant
rs727502863 A>C Pathogenic Stop gained, non coding transcript variant, coding sequence variant
rs727502864 ->G Pathogenic-likely-pathogenic Non coding transcript variant, frameshift variant, coding sequence variant
rs747109506 G>-,GG,GGG Conflicting-interpretations-of-pathogenicity Non coding transcript variant, frameshift variant, coding sequence variant
rs754099015 G>A Pathogenic Non coding transcript variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT027597 hsa-miR-98-5p Microarray 19088304
MIRT690717 hsa-miR-34b-3p HITS-CLIP 23313552
MIRT690716 hsa-miR-5588-3p HITS-CLIP 23313552
MIRT690715 hsa-miR-2114-5p HITS-CLIP 23313552
MIRT690714 hsa-miR-3614-5p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000922 Component Spindle pole IBA 21873635
GO:0000922 Component Spindle pole IDA 25466283
GO:0003674 Function Molecular_function ND
GO:0005829 Component Cytosol IBA 21873635
GO:0005829 Component Cytosol IDA 25466283
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616144 25928 ENSG00000177082
Protein
UniProt ID Q6P4I2
Protein name Integrator complex assembly factor WDR73 (WD repeat-containing protein 73)
Protein function Component of a multiprotein complex required for the assembly of the RNA endonuclease module of the integrator complex (PubMed:39032489). Associates with INTS9 and INTS11 in the cytoplasm, stabilizing the INTS9-INTS11 heterodimer and blocking th
PDB 8R22
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in kidney and brain. In the kidney, expressed in glomeruli, most probably in podocytes, and in tubules (at protein level). In the brain, expressed in the cerebellum, with high levels in Purkinje cells and their projecting axo
Sequence
MDPGDDWLVESLRLYQDFYAFDLSGATRVLEWIDDKGVFVAGYESLKKNEILHLKLPLRL
SVKENKGLFPERDFKVRHGGFSDRSIFDLKHVPHTRLLVTSGLPGCYLQVWQVAEDSDVI
KAVSTIAVHEKEESLWPRVAVFSTLAPGVLHGARLRSLQVVDLESRKTTYTSDVSDSEEL
SSLQVLDADTFAFCCASGRLGLVDTRQKWAPLENRSPGPGSGGERWCAEVGSWGQGPGPS
IASLGSDGRLCLLDPRDLCHPVSSVQCPVSVPSPDPELLRVTWAPGLKNCLAISGFDGTV
QVYDATSWDGTRSQDGTRSQVEPLFTHRGHIFLDGNGMDPAPLVTTHTWHPCRPRTLLSA
TNDASLHVWDWVDLCAPR
Sequence length 378
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Cataract Cataract rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322
View all (150 more)
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Galloway-mowat syndrome Galloway Mowat syndrome, GALLOWAY-MOWAT SYNDROME 1, Galloway-Mowat syndrome rs727502863, rs727502864, rs730882216, rs797044992, rs767086146, rs754099015, rs797044993, rs797044994, rs797044995, rs863223396, rs869320712, rs776760122, rs1555976610, rs1557211306, rs1557211209
View all (22 more)
25466283, 18019379, 26070982
Kidney disease Kidney Diseases rs74315342, rs749740335, rs757649673, rs112417755, rs35138315
Unknown
Disease term Disease name Evidence References Source
Ptosis Blepharoptosis, Ptosis ClinVar
Galloway-Mowat Syndrome Galloway-Mowat syndrome GenCC
CAMOS Syndrome CAMOS syndrome GenCC
Sarcoidosis Sarcoidosis GWAS
Associations from Text Mining
Disease Name Relationship Type References
Agenesis of Corpus Callosum Associate 27001912
Basal Ganglia Diseases Associate 26123727
Brain Stem Neoplasms Associate 27001912
Cerebellar Diseases Associate 26123727, 27001912
Depression Postpartum Associate 25466283
Diabetes Mellitus Type 2 Associate 37033211
Diabetic Nephropathies Associate 37033211
Epilepsy Associate 27001912
Galloway Mowat syndrome Associate 25466283, 26070982, 26123727, 27001912, 28720660, 33686175, 36755238
Growth Disorders Associate 26123727