Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	84905
Gene name Gene Name - the full gene name approved by the HGNC.	Zinc finger protein 341
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ZNF341
Synonyms (NCBI Gene) Gene synonyms aliases	HIES3
Disease Acronyms (UniProt) Disease acronyms from UniProt database	HIES3
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q11.22

Show/Hide all(5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs376598954	C>G,T	Pathogenic	Synonymous variant, stop gained, coding sequence variant, intron variant, non coding transcript variant
rs746141726	C>G,T	Pathogenic	Coding sequence variant, non coding transcript variant, stop gained, missense variant
rs982121798	C>T	Pathogenic	Coding sequence variant, stop gained, non coding transcript variant
rs1568940507	C>T	Pathogenic	Stop gained, non coding transcript variant, coding sequence variant
rs1568945329	G>-	Pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant

Show/Hide all(64)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018649	hsa-miR-335-5p	Microarray	18185580
MIRT1522847	hsa-miR-1244	CLIP-seq
MIRT1522848	hsa-miR-1245b-3p	CLIP-seq
MIRT1522849	hsa-miR-1291	CLIP-seq
MIRT1522850	hsa-miR-150	CLIP-seq
MIRT1522851	hsa-miR-1915	CLIP-seq
MIRT1522852	hsa-miR-296-5p	CLIP-seq
MIRT1522853	hsa-miR-3183	CLIP-seq
MIRT1522854	hsa-miR-3189-5p	CLIP-seq
MIRT1522855	hsa-miR-3690	CLIP-seq
MIRT1522856	hsa-miR-4279	CLIP-seq
MIRT1522857	hsa-miR-4308	CLIP-seq
MIRT1522858	hsa-miR-4323	CLIP-seq
MIRT1522859	hsa-miR-4713-5p	CLIP-seq
MIRT1522860	hsa-miR-4723-3p	CLIP-seq
MIRT1522861	hsa-miR-4726-3p	CLIP-seq
MIRT1522862	hsa-miR-487b	CLIP-seq
MIRT1522863	hsa-miR-532-3p	CLIP-seq
MIRT1522864	hsa-miR-711	CLIP-seq
MIRT2157924	hsa-miR-1185	CLIP-seq
MIRT2157925	hsa-miR-2110	CLIP-seq
MIRT2157926	hsa-miR-221	CLIP-seq
MIRT2157927	hsa-miR-222	CLIP-seq
MIRT2157928	hsa-miR-3120-5p	CLIP-seq
MIRT2157929	hsa-miR-3151	CLIP-seq
MIRT2157930	hsa-miR-3164	CLIP-seq
MIRT2157931	hsa-miR-331-3p	CLIP-seq
MIRT2157932	hsa-miR-3605-5p	CLIP-seq
MIRT2157933	hsa-miR-3616-5p	CLIP-seq
MIRT2157934	hsa-miR-3622a-3p	CLIP-seq
MIRT2157935	hsa-miR-3622b-3p	CLIP-seq
MIRT2157936	hsa-miR-3647-5p	CLIP-seq
MIRT2157937	hsa-miR-3679-5p	CLIP-seq
MIRT2157938	hsa-miR-3974	CLIP-seq
MIRT2157939	hsa-miR-4271	CLIP-seq
MIRT2157940	hsa-miR-4447	CLIP-seq
MIRT2157941	hsa-miR-4472	CLIP-seq
MIRT2157942	hsa-miR-4480	CLIP-seq
MIRT2157943	hsa-miR-4520a-5p	CLIP-seq
MIRT2157944	hsa-miR-4520b-5p	CLIP-seq
MIRT2157945	hsa-miR-4649-3p	CLIP-seq
MIRT2157946	hsa-miR-4725-3p	CLIP-seq
MIRT2157947	hsa-miR-4795-5p	CLIP-seq
MIRT2157948	hsa-miR-487a	CLIP-seq
MIRT2157949	hsa-miR-491-5p	CLIP-seq
MIRT2157950	hsa-miR-499-3p	CLIP-seq
MIRT2157951	hsa-miR-499a-3p	CLIP-seq
MIRT2157952	hsa-miR-515-3p	CLIP-seq
MIRT2157953	hsa-miR-519e	CLIP-seq
MIRT2157954	hsa-miR-544	CLIP-seq
MIRT2157955	hsa-miR-573	CLIP-seq
MIRT2157956	hsa-miR-626	CLIP-seq
MIRT2157957	hsa-miR-767-5p	CLIP-seq
MIRT2377436	hsa-miR-103b	CLIP-seq
MIRT2377437	hsa-miR-22	CLIP-seq
MIRT2377438	hsa-miR-24	CLIP-seq
MIRT2157930	hsa-miR-3164	CLIP-seq
MIRT2157933	hsa-miR-3616-5p	CLIP-seq
MIRT2157936	hsa-miR-3647-5p	CLIP-seq
MIRT2377439	hsa-miR-3919	CLIP-seq
MIRT2377440	hsa-miR-4437	CLIP-seq
MIRT2377441	hsa-miR-4756-3p	CLIP-seq
MIRT2157947	hsa-miR-4795-5p	CLIP-seq
MIRT2157955	hsa-miR-573	CLIP-seq

Show/Hide all(10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0001216	Function	DNA-binding transcription activator activity	IDA	29907690
GO:0003677	Function	DNA binding	IDA	29907690
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IDA	29907690
GO:0006355	Process	Regulation of transcription, DNA-templated	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
618269	15992	ENSG00000131061

Protein

UniProt ID

Q9BYN7

Protein name

Zinc finger protein 341

Protein function

Transcriptional activator of STAT3 involved in the regulation of immune homeostasis. Also able to activate STAT1 transcription.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13912	zf-C2H2_6	52 → 74		Domain
PF00096	zf-C2H2	322 → 344	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	350 → 372	Zinc finger, C2H2 type	Domain
PF13912	zf-C2H2_6	502 → 526		Domain
PF00096	zf-C2H2	622 → 644	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	650 → 677	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	683 → 705	Zinc finger, C2H2 type	Domain

Sequence

MAQAIFEALEGMDNQTVLAVQSLLDGQGAVPDPTGQSVNAPPAIQPLDDEDVFLCGKCKK
QFNSLPAFMTHKREQCQGNAPALATVSLATNSIYPPSAAPTAVQQAPTPANRQISTYITV
PPSPLIQTLVQGNILVSDDVLMSAMSAFTSLDQPMPQGPPPVQSSLNMHSVPSYLTQPPP
PPPPPPPLPPPPPPQPPPPPPQSLGPPGRPNPGGNGVVEVYSAAAPLAGSGTVEIQALGM
QPYPPLEVPNQCVEPPVYPTPTVYSPGKQGFKPKGPNPAAPMTSATGGTVATFDSPATLK
TRRAKGARGLPEAAGKPKAQKLKCSYCDKSFTKNFDLQQHIRSHTGEKPFQCIACGRAFA
QKSNVKKHMQTHKVWPPGHSGGTVSRNSVTVQVMALNPSRQEDEESTGLGQPLPGAPQPQ
ALSTAGEEEGDKPESKQVVLIDSSYLCQFCPSKFSTYFQLKSHMTQHKNEQVYKCVVKSC
AQTFPKLDTFLEHIKSHQEELSYRCHLCGKDFPSLYDLGVHQYSHSLLPQHSPKKDNAVY
KCVKCVNKYSTPEALEHHLQTATHNFPCPHCQKVFPCERYLRRHLPTHGSGGRFKCQVCK
KFFRREHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPFKKYKCPFSTHTGC
SKEFNRPDKLKAHILSHSGMKLHKCALCSKSFSRRAHLAEHQRAHTGNYKFRCAGCAKGF
SRHKYLKDHRCRLGPQKDKDLQTRRPPQRRAAPRSCGSGGRKVLTPLPDPLGLEELKDTG
AGLVPEAVPGKPPFAEPDAVLSIVVGGAVGAETELVVPGHAEGLGSNLALAELQAGAEGP
CAMLAVPVYIQASE

Sequence length

854

Interactions

View interactions

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID
Causal
Bronchiectasis	Bronchiectasis	rs121908758, rs121908811, rs76649725, rs267606722, rs121909008, rs387906360, rs387906361, rs80034486, rs74767530, rs121908776, rs121909012, rs77646904, rs121908754, rs121909015, rs121909016 View all (214 more)
Dermatitis	Dermatitis, Atopic	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Evidence	Source
Unknown
Otitis media	Recurrent otitis media		ClinVar
Diabetes	Diabetes		GWAS
Prostate cancer	Prostate cancer	Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population.	GWAS, CBGDA

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Inflammation	Associate	29907691
Job Syndrome	Associate	29907691, 29907692, 35185921

ZNF341 (zinc finger protein 341)