Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84904
Gene name Gene Name - the full gene name approved by the HGNC.
Rho guanine nucleotide exchange factor 39
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ARHGEF39
Synonyms (NCBI Gene) Gene synonyms aliases
C9orf100, XGEF
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9p13.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT624674 hsa-miR-6813-3p HITS-CLIP 23824327
MIRT624673 hsa-miR-125a-3p HITS-CLIP 23824327
MIRT680115 hsa-miR-764 HITS-CLIP 23824327
MIRT680114 hsa-miR-3934-5p HITS-CLIP 23824327
MIRT624672 hsa-miR-1224-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005085 Function Guanyl-nucleotide exchange factor activity IEA
GO:0005515 Function Protein binding IPI 25416956, 31515488, 33961781
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 22327280
GO:0005886 Component Plasma membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
621172 25909 ENSG00000137135
Protein
UniProt ID Q8N4T4
Protein name Rho guanine nucleotide exchange factor 39
Protein function Promotes cell proliferation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00621 RhoGEF 26 195 RhoGEF domain Domain
Tissue specificity TISSUE SPECIFICITY: Strongly expressed in hepatocellular carcinoma (HCC) compared with their non-cancerous counterparts. {ECO:0000269|PubMed:22327280}.
Sequence
MELSCPGSRCPVQEQRARWERKRACTARELLETERRYQEQLGLVATYFLGILKAKGTLRP
PERQALFGSWELIYGASQELLPYLEGGCWGQGLEGFCRHLELYNQFAANSERSQTTLQEQ
LKKNKGFRRFVRLQEGRPEFGGLQLQDLLPLPLQRLQQYENLVVALAENTGPNSPDHQQL
TRAARLISETAQRVH
TIGQKQKNDQHLRRVQALLSGRQAKGLTSGRWFLRQGWLLVVPPH
GEPRPRMFFLFTDVLLMAKPRPPLHLLRSGTFACKALYPMAQCHLSRVFGHSGGPCGGLL
SLSFPHEKLLLMSTDQEELSRWYHSLTWAISSQKN
Sequence length 335
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    NRAGE signals death through JNK
Rho GTPase cycle
G alpha (12/13) signalling events
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Severe insulin-deficient type 2 diabetes, Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 34731623
Bipolar Disorder Associate 28289279
Breast Neoplasms Associate 33413557
Carcinoma Hepatocellular Associate 31626606
Language Disorders Associate 28289279
Lung Neoplasms Associate 34731623
Mental Disorders Associate 28289279
Neoplasms Stimulate 31626606
Neurologic Manifestations Associate 28289279
Specific Language Disorder Associate 28289279