Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	84875
Gene name Gene Name - the full gene name approved by the HGNC.	Poly(ADP-ribose) polymerase family member 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PARP10
Synonyms (NCBI Gene) Gene synonyms aliases	ARTD10
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q24.3
Summary Summary of gene provided in NCBI Entrez Gene.	Poly(ADP-ribose) polymerases (PARPs), such as PARP10, regulate gene transcription by altering chromatin organization by adding ADP-ribose to histones. PARPs can also function as transcriptional cofactors (Yu et al., 2005 [PubMed 15674325]).[supplied by OM

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1587459606	AG>-	Likely-pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant

Show/Hide all(38)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019078	hsa-miR-335-5p	Microarray	18185580
MIRT045838	hsa-miR-132-3p	CLASH	23622248
MIRT039387	hsa-miR-421	CLASH	23622248
MIRT1214361	hsa-miR-1275	CLIP-seq
MIRT1214362	hsa-miR-1908	CLIP-seq
MIRT1214363	hsa-miR-3180	CLIP-seq
MIRT1214364	hsa-miR-3180-3p	CLIP-seq
MIRT1214365	hsa-miR-3196	CLIP-seq
MIRT1214366	hsa-miR-4259	CLIP-seq
MIRT1214367	hsa-miR-4488	CLIP-seq
MIRT1214368	hsa-miR-4665-5p	CLIP-seq
MIRT1214369	hsa-miR-4697-5p	CLIP-seq
MIRT1214370	hsa-miR-4706	CLIP-seq
MIRT1214371	hsa-miR-4711-5p	CLIP-seq
MIRT1214372	hsa-miR-4749-5p	CLIP-seq
MIRT1214373	hsa-miR-663	CLIP-seq
MIRT1214374	hsa-miR-939	CLIP-seq
MIRT2061666	hsa-miR-4459	CLIP-seq
MIRT2061667	hsa-miR-4646-5p	CLIP-seq
MIRT2061668	hsa-miR-4695-5p	CLIP-seq
MIRT2061669	hsa-miR-4722-5p	CLIP-seq
MIRT2061670	hsa-miR-4747-5p	CLIP-seq
MIRT2290029	hsa-miR-3192	CLIP-seq
MIRT2290030	hsa-miR-4300	CLIP-seq
MIRT2290031	hsa-miR-4487	CLIP-seq
MIRT2061667	hsa-miR-4646-5p	CLIP-seq
MIRT2061670	hsa-miR-4747-5p	CLIP-seq
MIRT2290032	hsa-miR-661	CLIP-seq
MIRT2290033	hsa-miR-920	CLIP-seq
MIRT2588050	hsa-miR-323-5p	CLIP-seq
MIRT2588051	hsa-miR-331-3p	CLIP-seq
MIRT2588052	hsa-miR-3649	CLIP-seq
MIRT2588053	hsa-miR-4456	CLIP-seq
MIRT2588054	hsa-miR-4505	CLIP-seq
MIRT2588055	hsa-miR-541	CLIP-seq
MIRT2588056	hsa-miR-615-5p	CLIP-seq
MIRT2588057	hsa-miR-654-5p	CLIP-seq
MIRT2588058	hsa-miR-876-3p	CLIP-seq

Show/Hide all(45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IBA
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IEA
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IMP	23473667, 23575687
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	TAS
GO:0005515	Function	Protein binding	IPI	22176891, 23473667, 23481255, 24695737
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15674325, 22176891, 23473667
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15674325, 22176891, 23473667
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006325	Process	Chromatin organization	IDA	15674325
GO:0006974	Process	DNA damage response	IEA
GO:0010629	Process	Negative regulation of gene expression	IBA
GO:0010629	Process	Negative regulation of gene expression	IMP	23575687
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0019082	Process	Viral protein processing	TAS
GO:0019985	Process	Translesion synthesis	IDA	24695737
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IMP	23575687
GO:0034355	Process	NAD+ biosynthetic process via the salvage pathway	TAS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0048147	Process	Negative regulation of fibroblast proliferation	IDA	15674325
GO:0070212	Process	Protein poly-ADP-ribosylation	IDA	15674325
GO:0070212	Process	Protein poly-ADP-ribosylation	IEA
GO:0070212	Process	Protein poly-ADP-ribosylation	IMP	23473667
GO:0070213	Process	Protein auto-ADP-ribosylation	IDA	25043379
GO:0070213	Process	Protein auto-ADP-ribosylation	IMP	23575687
GO:0070530	Function	K63-linked polyubiquitin modification-dependent protein binding	IMP	23575687
GO:0140297	Function	DNA-binding transcription factor binding	IPI	15674325
GO:0140804	Function	NAD+-protein-lysine ADP-ribosyltransferase activity	IEA
GO:0140806	Function	NAD+-protein-aspartate ADP-ribosyltransferase activity	IEA
GO:0140807	Function	NAD+-protein-glutamate ADP-ribosyltransferase activity	IEA
GO:1900045	Process	Negative regulation of protein K63-linked ubiquitination	IMP	23575687
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	IDA	18851833, 25043379
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	IEA
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	IMP	24695737

MIM	HGNC	e!Ensembl
609564	25895	ENSG00000178685

Protein

UniProt ID

Q53GL7

Protein name

Protein mono-ADP-ribosyltransferase PARP10 (EC 2.4.2.-) (ADP-ribosyltransferase diphtheria toxin-like 10) (ARTD10) (Poly [ADP-ribose] polymerase 10) (PARP-10)

Protein function

ADP-ribosyltransferase that mediates mono-ADP-ribosylation of glutamate and aspartate residues on target proteins (PubMed:18851833, PubMed:23332125, PubMed:23474714, PubMed:25043379). In contrast to PARP1 and PARP2, it is not able to mediate pol

PDB

2DHX , 3HKV , 5LX6 , 6FXI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00644	PARP	827 → 1006	Poly(ADP-ribose) polymerase catalytic domain	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in spleen and thymus (PubMed:15674325). Intermediate levels in liver, kidney, pancreas, prostate, testis, ovary, intestine, and leukocytes (PubMed:15674325). Low expression in heart, brain, placenta, lung, skeletal mus

Sequence

MVAMAEAEAGVAVEVRGLPPAVPDELLTLYFENRRRSGGGPVLSWQRLGCGGVLTFREPA
DAERVLAQADHELHGAQLSLRPAPPRAPARLLLQGLPPGTTPQRLEQHVQALLRASGLPV
QPCCALASPRPDRALVQLPKPLSEADVRVLEEQAQNLGLEGTLVSLARVPQARAVRVVGD
GASVDLLLLELYLENERRSGGGPLEDLQRLPGPLGTVASFQQWQVAERVLQQEHRLQGSE
LSLVPHYDILEPEELAENTSGGDHPSTQGPRATKHALLRTGGLVTALQGAGTVTMGSGEE
PGQSGASLRTGPMVQGRGIMTTGSGQEPGQSGTSLRTGPMGSLGQAEQVSSMPMGSLEHE
GLVSLRPVGLQEQEGPMSLGPVGSAGPVETSKGLLGQEGLVEIAMDSPEQEGLVGPMEIT
MGSLEKAGPVSPGCVKLAGQEGLVEMVLLMEPGAMRFLQLYHEDLLAGLGDVALLPLEGP
DMTGFRLCGAQASCQAAEEFLRSLLGSISCHVLCLEHPGSARFLLGPEGQHLLQGLEAQF
QCVFGTERLATATLDTGLEEVDPTEALPVLPGNAHTLWTPDSTGGDQEDVSLEEVRELLA
TLEGLDLDGEDWLPRELEEEGPQEQPEEEVTPGHEEEEPVAPSTVAPRWLEEEAALQLAL
HRSLEPQGQVAEQEEAAALRQALTLSLLEQPPLEAEEPPDGGTDGKAQLVVHSAFEQDVE
ELDRALRAALEVHVQEETVGPWRRTLPAELRARLERCHGVSVALRGDCTILRGFGAHPAR
AARHLVALLAGPWDQSLAFPLAASGPTLAGQTLKGPWNNLERLAENTGEFQEVVRAFYDT
LDAARSSIRVVRVERVSHPLLQQQYELYRERLLQRCERRPVEQVLYHGTTAPAVPDICAH
GFNRSFCGRNATVYGKGVYFARRASLSVQDRYSPPNADGHKAVFVARVLTGDYGQGRRGL
RAPPLRGPGHVLLRYDSAVDCICQPSIFVIFHDTQALPTHLITCEHVPRASPDDPSGLPG
RSPDT

Sequence length

1025

Interactions

View interactions

	Reactome
			Nicotinamide salvaging

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
developmental delay	Developmental delay	rs1587459606	N/A

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Bipolar Disorder	Bipolar disorder, Bipolar I disorder	N/A	N/A	GWAS

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Cockayne Syndrome	Associate	27624574
Developmental Disabilities	Associate	27624574
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	36187556
Leukemia Myeloid Acute	Associate	37506247
Leukemia Prolymphocytic T Cell	Associate	29352181
Lymphoma Follicular	Associate	34791836
Neoplasms	Stimulate	36187556

PARP10 (poly(ADP-ribose) polymerase family member 10)