AGBL4 (AGBL carboxypeptidase 4)

Gene

• Entrez ID: 84871
• Gene name: AGBL carboxypeptidase 4
• Gene symbol: AGBL4
• Synonyms (NCBI Gene): CCP6
• Chromosome: 1
• Chromosome location: 1p33

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT771678	hsa-miR-1238	CLIP-seq
MIRT771679	hsa-miR-1254	CLIP-seq
MIRT771680	hsa-miR-1290	CLIP-seq
MIRT771681	hsa-miR-1825	CLIP-seq
MIRT771682	hsa-miR-3116	CLIP-seq
MIRT771683	hsa-miR-3120-5p	CLIP-seq
MIRT771684	hsa-miR-3128	CLIP-seq
MIRT771685	hsa-miR-3140-3p	CLIP-seq
MIRT771686	hsa-miR-4254	CLIP-seq
MIRT771687	hsa-miR-4292	CLIP-seq
MIRT771688	hsa-miR-4308	CLIP-seq
MIRT771689	hsa-miR-4475	CLIP-seq
MIRT771690	hsa-miR-450b-5p	CLIP-seq
MIRT771691	hsa-miR-4691-5p	CLIP-seq
MIRT771692	hsa-miR-4765	CLIP-seq
MIRT771693	hsa-miR-502-5p	CLIP-seq
MIRT771694	hsa-miR-507	CLIP-seq
MIRT771695	hsa-miR-511	CLIP-seq
MIRT771696	hsa-miR-520f	CLIP-seq
MIRT771697	hsa-miR-557	CLIP-seq
MIRT771698	hsa-miR-661	CLIP-seq
MIRT771690	hsa-miR-450b-5p	CLIP-seq
MIRT1927740	hsa-miR-4530	CLIP-seq
MIRT771694	hsa-miR-507	CLIP-seq
MIRT771697	hsa-miR-557	CLIP-seq
MIRT1927741	hsa-miR-922	CLIP-seq
MIRT2168574	hsa-miR-1298	CLIP-seq
MIRT2168575	hsa-miR-2355-5p	CLIP-seq
MIRT2168576	hsa-miR-3674	CLIP-seq
MIRT2168577	hsa-miR-412	CLIP-seq
MIRT771688	hsa-miR-4308	CLIP-seq
MIRT1927740	hsa-miR-4530	CLIP-seq
MIRT771691	hsa-miR-4691-5p	CLIP-seq
MIRT2168578	hsa-miR-4719	CLIP-seq
MIRT2168579	hsa-miR-4775	CLIP-seq
MIRT2168580	hsa-miR-485-3p	CLIP-seq
MIRT2168581	hsa-miR-487a	CLIP-seq
MIRT1927741	hsa-miR-922	CLIP-seq
MIRT2443306	hsa-miR-216a	CLIP-seq
MIRT2443307	hsa-miR-216b	CLIP-seq
MIRT2443308	hsa-miR-371-5p	CLIP-seq
MIRT2443309	hsa-miR-495	CLIP-seq
MIRT2443310	hsa-miR-515-5p	CLIP-seq
MIRT2443311	hsa-miR-888	CLIP-seq
MIRT2471190	hsa-miR-452	CLIP-seq
MIRT2471191	hsa-miR-4676-3p	CLIP-seq
MIRT2471190	hsa-miR-452	CLIP-seq
MIRT2471191	hsa-miR-4676-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004180	Function	Carboxypeptidase activity	IEA
GO:0004181	Function	Metallocarboxypeptidase activity	IBA
GO:0004181	Function	Metallocarboxypeptidase activity	IEA
GO:0004181	Function	Metallocarboxypeptidase activity	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA	23085998
GO:0005794	Component	Golgi apparatus	IEA
GO:0005814	Component	Centriole	IDA	23085998
GO:0005814	Component	Centriole	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0015630	Component	Microtubule cytoskeleton	IBA
GO:0015631	Function	Tubulin binding	IBA
GO:0015631	Function	Tubulin binding	IEA
GO:0015631	Function	Tubulin binding	ISS
GO:0016787	Function	Hydrolase activity	IEA
GO:0021954	Process	Central nervous system neuron development	IEA
GO:0030424	Component	Axon	IEA
GO:0035608	Process	Protein deglutamylation	ISS
GO:0035609	Process	C-terminal protein deglutamylation	ISS
GO:0035610	Process	Protein side chain deglutamylation	ISS
GO:0036064	Component	Ciliary basal body	IBA
GO:0036064	Component	Ciliary basal body	IDA	23085998
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	ISS
GO:0098930	Process	Axonal transport	IEA
GO:0098957	Process	Anterograde axonal transport of mitochondrion	IEA
GO:0098958	Process	Retrograde axonal transport of mitochondrion	IEA
GO:0120222	Process	Regulation of blastocyst development	IEA
GO:1904115	Component	Axon cytoplasm	IEA
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IEA

Other IDs

• MIM: 616476
• HGNC: 25892
• e!Ensembl: ENSG00000186094

Protein

• UniProt ID: Q5VU57
• Protein name: Cytosolic carboxypeptidase 6 (EC 3.4.17.24) (ATP/GTP-binding protein-like 4) (Protein deglutamylase CCP6)
• Protein function: Metallocarboxypeptidase that mediates protein deglutamylation of tubulin and non-tubulin target proteins. Catalyzes the removal of polyglutamate side chains present on the gamma-carboxyl group of glutamate residues within the C-terminal tail of
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF18027	Pepdidase_M14_N	46 → 166	Cytosolic carboxypeptidase N-terminal domain	Domain
  PF00246	Peptidase_M14	174 → 439	Zinc carboxypeptidase	Domain

• Sequence:

  MAEGSQSAPEAGNDMGNDDAIGGNVSKYIVLPTGYCGQPKKGHLIFDACFESGNLGRVDQ
  VSEFEYDLFIRPDTCNPRFRVWFNFTVENVKESQRVIFNIVNFSKTKSLYRDGMAPMVKS
  TSRPKWQRLPPKNVYYYRCPDHRKNYVMSFAFCFDREEDIYQFAYCYPYTYTRFQHYLDS
  LQKRNMDYFFREQLGQSVQQRKLDLLTITSPDNLREGAEQKVVFITGRVHPGETPSSFVC
  QGIIDFLVSQHPIACVLREYLVFKIAPMLNPDGVYLGNYRCSLMGFDLNRHWLDPSPWVH
  PTLHGVKQLIVQMYNDPKTSLEFYIDIHAHSTMMNGFMYGNIFEDEERFQRQAIFPKLLC
  QNAEDFSYSSTSFNRDAVKAGTGRRFLGGLLDHTSYCYTLEVSFYSYIISGTTAAVPYTE
  EAYMKLGRNVARTFLDYYRLNPVVEKVAIPMPRLRNKEIEVQRRKEKSPPYKHPLLRGPA
  SNYPNSKGDKKSSVNHKDPSTPF

• Sequence length: 503

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
AGBL4-related disorder	Benign; Likely benign	rs60977321, rs3934240, rs138271641, rs770755809, rs80256865, rs373001734, rs764055566, rs897258395, rs75333004, rs41289226	RCV003973814 RCV003977320 RCV003952188 RCV003961798 RCV003917122 RCV003939395 RCV003932051 RCV003969386 RCV003976535 RCV003981331
Lung cancer	Benign	rs75333004	RCV005935185
Ovarian serous cystadenocarcinoma	Benign	rs75333004	RCV005935183
Thymoma	Benign	rs75333004	RCV005935184
Uterine corpus endometrial carcinoma	Benign	rs75333004	RCV005935186

Associations from Text Mining
Disease Name	Relationship Type	References
Carcinoma Renal Cell	Inhibit	26993597
Cerebral Infarction	Associate	37370144
Glioblastoma	Associate	35295612
Macular Degeneration	Associate	23365078
Necrosis	Associate	17293598
Triglyceride Storage Disease Type I	Associate	27853278