Gene Gene information from NCBI Gene database.
Entrez ID 84870
Gene name R-spondin 3
Gene symbol RSPO3
Synonyms (NCBI Gene)
CRISTIN1PWTSRTHSD2
Chromosome 6
Chromosome location 6q22.33
Summary This gene belongs to the R-spondin family. The encoded protein plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell g
miRNA miRNA information provided by mirtarbase database.
146
miRTarBase ID miRNA Experiments Reference
MIRT017040 hsa-miR-335-5p Microarray 18185580
MIRT1321411 hsa-miR-3163 CLIP-seq
MIRT1321412 hsa-miR-3619-3p CLIP-seq
MIRT1321413 hsa-miR-4503 CLIP-seq
MIRT1321414 hsa-miR-4659a-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0001974 Process Blood vessel remodeling IEA
GO:0001974 Process Blood vessel remodeling ISS
GO:0002040 Process Sprouting angiogenesis IEA
GO:0002040 Process Sprouting angiogenesis ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610574 20866 ENSG00000146374
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BXY4
Protein name R-spondin-3 (Protein with TSP type-1 repeat) (hPWTSR) (Roof plate-specific spondin-3) (hRspo3) (Thrombospondin type-1 domain-containing protein 2)
Protein function Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors, which acts as a key regulator of angiogenesis. Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled recep
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15913 Furin-like_2 41 142 Furin-like repeat, cysteine-rich Domain
PF19028 TSP1_spondin 148 206 Spondin-like TSP1 domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. Expressed at higher level in placenta, small intestine, fetal thymus and lymph node (PubMed:12463421). Highly expressed in endothelial cells (PubMed:26766444). {ECO:0000269|PubMed:12463421, ECO:0000269|PubMed:26
Sequence
MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPR
LFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYL
HLGKCLDNCPEGLEANNHTMEC
VSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREII
QHPSAKGNLCPPTNETRKCTVQRKKC
QKGERGKKGRERKRKKPNKGESKEAIPDSKSLES
SKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH
Sequence length 272
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Wnt signaling pathway   Regulation of FZD by ubiquitination
RUNX1 regulates transcription of genes involved in WNT signaling