Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	84868
Gene name Gene Name - the full gene name approved by the HGNC.	Hepatitis A virus cellular receptor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HAVCR2
Synonyms (NCBI Gene) Gene synonyms aliases	CD366, HAVcr-2, KIM-3, SPTCL, TIM3, TIMD-3, TIMD3, Tim-3
Disease Acronyms (UniProt) Disease acronyms from UniProt database	SPTCL
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q33.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the immunoglobulin superfamily, and TIM family of proteins. CD4-positive T helper lymphocytes can be divided into types 1 (Th1) and 2 (Th2) on the basis of their cytokine secretion patterns. Th1 cells are involv

Show/Hide all(3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs35960726	T>C	Risk-factor	Coding sequence variant, missense variant
rs147827860	G>A	Risk-factor	Coding sequence variant, missense variant
rs184868814	T>C	Risk-factor	Missense variant, coding sequence variant

Show/Hide all(302)

miRTarBase ID	miRNA	Experiments	Reference
MIRT459333	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT459332	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT459331	hsa-miR-940	PAR-CLIP	23592263
MIRT459330	hsa-miR-302c-3p	PAR-CLIP	23592263
MIRT459329	hsa-miR-520f-3p	PAR-CLIP	23592263
MIRT459328	hsa-miR-1825	PAR-CLIP	23592263
MIRT459327	hsa-miR-1827	PAR-CLIP	23592263
MIRT459326	hsa-miR-6089	PAR-CLIP	23592263
MIRT459325	hsa-miR-1251-3p	PAR-CLIP	23592263
MIRT459324	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT459323	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT459322	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT459321	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT459320	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT459319	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT459318	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT459317	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT459316	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT459315	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT459314	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT459313	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT459312	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT459311	hsa-miR-3689c	PAR-CLIP	23592263
MIRT459310	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT459309	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT459308	hsa-miR-450a-1-3p	PAR-CLIP	23592263
MIRT459307	hsa-miR-3122	PAR-CLIP	23592263
MIRT459306	hsa-miR-3913-5p	PAR-CLIP	23592263
MIRT459305	hsa-miR-887-5p	PAR-CLIP	23592263
MIRT459304	hsa-miR-6513-5p	PAR-CLIP	23592263
MIRT733387	hsa-miR-133a-5p	qRT-PCR, Flow cytometry	32647415
MIRT459333	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT459332	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT459331	hsa-miR-940	PAR-CLIP	23592263
MIRT459330	hsa-miR-302c-3p	PAR-CLIP	23592263
MIRT459329	hsa-miR-520f-3p	PAR-CLIP	23592263
MIRT459328	hsa-miR-1825	PAR-CLIP	23592263
MIRT459327	hsa-miR-1827	PAR-CLIP	23592263
MIRT459326	hsa-miR-6089	PAR-CLIP	23592263
MIRT459325	hsa-miR-1251-3p	PAR-CLIP	23592263
MIRT459324	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT459323	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT459322	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT459321	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT459320	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT459319	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT459318	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT459317	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT459316	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT459315	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT459314	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT459313	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT459312	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT459311	hsa-miR-3689c	PAR-CLIP	23592263
MIRT459310	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT459309	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT459308	hsa-miR-450a-1-3p	PAR-CLIP	23592263
MIRT459307	hsa-miR-3122	PAR-CLIP	23592263
MIRT459306	hsa-miR-3913-5p	PAR-CLIP	23592263
MIRT459305	hsa-miR-887-5p	PAR-CLIP	23592263
MIRT459304	hsa-miR-6513-5p	PAR-CLIP	23592263
MIRT1041408	hsa-miR-1227	CLIP-seq
MIRT1041409	hsa-miR-193a-3p	CLIP-seq
MIRT1041410	hsa-miR-193b	CLIP-seq
MIRT1041411	hsa-miR-24	CLIP-seq
MIRT1041412	hsa-miR-25	CLIP-seq
MIRT1041413	hsa-miR-32	CLIP-seq
MIRT1041414	hsa-miR-363	CLIP-seq
MIRT1041415	hsa-miR-3664-3p	CLIP-seq
MIRT1041416	hsa-miR-367	CLIP-seq
MIRT1041417	hsa-miR-3672	CLIP-seq
MIRT1041418	hsa-miR-3926	CLIP-seq
MIRT1041419	hsa-miR-3929	CLIP-seq
MIRT1041420	hsa-miR-4284	CLIP-seq
MIRT1041421	hsa-miR-4325	CLIP-seq
MIRT1041422	hsa-miR-4419b	CLIP-seq
MIRT1041423	hsa-miR-4433	CLIP-seq
MIRT1041424	hsa-miR-4459	CLIP-seq
MIRT1041425	hsa-miR-4478	CLIP-seq
MIRT1041426	hsa-miR-4537	CLIP-seq
MIRT1041427	hsa-miR-4649-3p	CLIP-seq
MIRT1041428	hsa-miR-4691-3p	CLIP-seq
MIRT1041429	hsa-miR-4695-5p	CLIP-seq
MIRT1041430	hsa-miR-4768-3p	CLIP-seq
MIRT1041431	hsa-miR-4786-5p	CLIP-seq
MIRT1041432	hsa-miR-485-5p	CLIP-seq
MIRT1041433	hsa-miR-510	CLIP-seq
MIRT1041434	hsa-miR-520f	CLIP-seq
MIRT1041435	hsa-miR-548s	CLIP-seq
MIRT1041436	hsa-miR-769-5p	CLIP-seq
MIRT1041437	hsa-miR-92a	CLIP-seq
MIRT1041438	hsa-miR-92b	CLIP-seq
MIRT2008672	hsa-miR-1205	CLIP-seq
MIRT1041408	hsa-miR-1227	CLIP-seq
MIRT2008673	hsa-miR-1285	CLIP-seq
MIRT2008674	hsa-miR-1909	CLIP-seq
MIRT1041412	hsa-miR-25	CLIP-seq
MIRT2008675	hsa-miR-3173-5p	CLIP-seq
MIRT2008676	hsa-miR-3187-5p	CLIP-seq
MIRT1041413	hsa-miR-32	CLIP-seq
MIRT2008677	hsa-miR-3613-3p	CLIP-seq
MIRT1041414	hsa-miR-363	CLIP-seq
MIRT1041415	hsa-miR-3664-3p	CLIP-seq
MIRT1041416	hsa-miR-367	CLIP-seq
MIRT2008678	hsa-miR-371-5p	CLIP-seq
MIRT2008679	hsa-miR-371b-5p	CLIP-seq
MIRT1041419	hsa-miR-3929	CLIP-seq
MIRT1041421	hsa-miR-4325	CLIP-seq
MIRT1041422	hsa-miR-4419b	CLIP-seq
MIRT2008680	hsa-miR-4432	CLIP-seq
MIRT1041423	hsa-miR-4433	CLIP-seq
MIRT2008681	hsa-miR-4436b-3p	CLIP-seq
MIRT1041424	hsa-miR-4459	CLIP-seq
MIRT1041425	hsa-miR-4478	CLIP-seq
MIRT2008682	hsa-miR-451b	CLIP-seq
MIRT1041427	hsa-miR-4649-3p	CLIP-seq
MIRT2008683	hsa-miR-4690-3p	CLIP-seq
MIRT1041428	hsa-miR-4691-3p	CLIP-seq
MIRT1041429	hsa-miR-4695-5p	CLIP-seq
MIRT2008684	hsa-miR-4696	CLIP-seq
MIRT2008685	hsa-miR-4722-5p	CLIP-seq
MIRT1041430	hsa-miR-4768-3p	CLIP-seq
MIRT1041432	hsa-miR-485-5p	CLIP-seq
MIRT2008686	hsa-miR-508-5p	CLIP-seq
MIRT1041433	hsa-miR-510	CLIP-seq
MIRT1041434	hsa-miR-520f	CLIP-seq
MIRT2008687	hsa-miR-612	CLIP-seq
MIRT2008688	hsa-miR-661	CLIP-seq
MIRT2008689	hsa-miR-665	CLIP-seq
MIRT2008690	hsa-miR-766	CLIP-seq
MIRT1041437	hsa-miR-92a	CLIP-seq
MIRT1041438	hsa-miR-92b	CLIP-seq
MIRT1041408	hsa-miR-1227	CLIP-seq
MIRT2008673	hsa-miR-1285	CLIP-seq
MIRT1041412	hsa-miR-25	CLIP-seq
MIRT2008676	hsa-miR-3187-5p	CLIP-seq
MIRT1041413	hsa-miR-32	CLIP-seq
MIRT1041414	hsa-miR-363	CLIP-seq
MIRT1041415	hsa-miR-3664-3p	CLIP-seq
MIRT1041416	hsa-miR-367	CLIP-seq
MIRT1041419	hsa-miR-3929	CLIP-seq
MIRT1041421	hsa-miR-4325	CLIP-seq
MIRT2241112	hsa-miR-4327	CLIP-seq
MIRT1041422	hsa-miR-4419b	CLIP-seq
MIRT2008680	hsa-miR-4432	CLIP-seq
MIRT1041423	hsa-miR-4433	CLIP-seq
MIRT1041424	hsa-miR-4459	CLIP-seq
MIRT1041425	hsa-miR-4478	CLIP-seq
MIRT2008682	hsa-miR-451b	CLIP-seq
MIRT1041426	hsa-miR-4537	CLIP-seq
MIRT2241113	hsa-miR-4639-3p	CLIP-seq
MIRT1041427	hsa-miR-4649-3p	CLIP-seq
MIRT2241114	hsa-miR-4661-3p	CLIP-seq
MIRT1041428	hsa-miR-4691-3p	CLIP-seq
MIRT1041429	hsa-miR-4695-5p	CLIP-seq
MIRT2008684	hsa-miR-4696	CLIP-seq
MIRT2008685	hsa-miR-4722-5p	CLIP-seq
MIRT2241115	hsa-miR-4742-5p	CLIP-seq
MIRT1041430	hsa-miR-4768-3p	CLIP-seq
MIRT1041432	hsa-miR-485-5p	CLIP-seq
MIRT2008686	hsa-miR-508-5p	CLIP-seq
MIRT1041433	hsa-miR-510	CLIP-seq
MIRT1041434	hsa-miR-520f	CLIP-seq
MIRT2008687	hsa-miR-612	CLIP-seq
MIRT2008688	hsa-miR-661	CLIP-seq
MIRT2008689	hsa-miR-665	CLIP-seq
MIRT2008690	hsa-miR-766	CLIP-seq
MIRT1041437	hsa-miR-92a	CLIP-seq
MIRT1041438	hsa-miR-92b	CLIP-seq
MIRT1041428	hsa-miR-4691-3p	CLIP-seq
MIRT1041433	hsa-miR-510	CLIP-seq
MIRT1041434	hsa-miR-520f	CLIP-seq
MIRT2008673	hsa-miR-1285	CLIP-seq
MIRT1041412	hsa-miR-25	CLIP-seq
MIRT2008676	hsa-miR-3187-5p	CLIP-seq
MIRT1041413	hsa-miR-32	CLIP-seq
MIRT2008677	hsa-miR-3613-3p	CLIP-seq
MIRT1041414	hsa-miR-363	CLIP-seq
MIRT1041415	hsa-miR-3664-3p	CLIP-seq
MIRT1041416	hsa-miR-367	CLIP-seq
MIRT2008678	hsa-miR-371-5p	CLIP-seq
MIRT2008679	hsa-miR-371b-5p	CLIP-seq
MIRT1041419	hsa-miR-3929	CLIP-seq
MIRT1041421	hsa-miR-4325	CLIP-seq
MIRT1041422	hsa-miR-4419b	CLIP-seq
MIRT2008680	hsa-miR-4432	CLIP-seq
MIRT1041423	hsa-miR-4433	CLIP-seq
MIRT1041424	hsa-miR-4459	CLIP-seq
MIRT1041425	hsa-miR-4478	CLIP-seq
MIRT2008682	hsa-miR-451b	CLIP-seq
MIRT1041427	hsa-miR-4649-3p	CLIP-seq
MIRT1041428	hsa-miR-4691-3p	CLIP-seq
MIRT1041429	hsa-miR-4695-5p	CLIP-seq
MIRT2008684	hsa-miR-4696	CLIP-seq
MIRT2008685	hsa-miR-4722-5p	CLIP-seq
MIRT1041430	hsa-miR-4768-3p	CLIP-seq
MIRT1041432	hsa-miR-485-5p	CLIP-seq
MIRT2008686	hsa-miR-508-5p	CLIP-seq
MIRT1041433	hsa-miR-510	CLIP-seq
MIRT1041434	hsa-miR-520f	CLIP-seq
MIRT2008687	hsa-miR-612	CLIP-seq
MIRT2008688	hsa-miR-661	CLIP-seq
MIRT2008689	hsa-miR-665	CLIP-seq
MIRT2008690	hsa-miR-766	CLIP-seq
MIRT1041437	hsa-miR-92a	CLIP-seq
MIRT1041438	hsa-miR-92b	CLIP-seq
MIRT1041434	hsa-miR-520f	CLIP-seq
MIRT2544659	hsa-miR-10a	CLIP-seq
MIRT2544660	hsa-miR-10b	CLIP-seq
MIRT2008673	hsa-miR-1285	CLIP-seq
MIRT1041412	hsa-miR-25	CLIP-seq
MIRT2544661	hsa-miR-3065-5p	CLIP-seq
MIRT2008676	hsa-miR-3187-5p	CLIP-seq
MIRT1041413	hsa-miR-32	CLIP-seq
MIRT2544662	hsa-miR-323-5p	CLIP-seq
MIRT2544663	hsa-miR-339-5p	CLIP-seq
MIRT2008677	hsa-miR-3613-3p	CLIP-seq
MIRT2544664	hsa-miR-3622b-5p	CLIP-seq
MIRT1041414	hsa-miR-363	CLIP-seq
MIRT1041415	hsa-miR-3664-3p	CLIP-seq
MIRT1041416	hsa-miR-367	CLIP-seq
MIRT2008678	hsa-miR-371-5p	CLIP-seq
MIRT2008679	hsa-miR-371b-5p	CLIP-seq
MIRT1041419	hsa-miR-3929	CLIP-seq
MIRT2544665	hsa-miR-3945	CLIP-seq
MIRT2544666	hsa-miR-4253	CLIP-seq
MIRT1041421	hsa-miR-4325	CLIP-seq
MIRT1041422	hsa-miR-4419b	CLIP-seq
MIRT2544667	hsa-miR-4421	CLIP-seq
MIRT2008680	hsa-miR-4432	CLIP-seq
MIRT1041423	hsa-miR-4433	CLIP-seq
MIRT1041424	hsa-miR-4459	CLIP-seq
MIRT1041425	hsa-miR-4478	CLIP-seq
MIRT2008682	hsa-miR-451b	CLIP-seq
MIRT1041427	hsa-miR-4649-3p	CLIP-seq
MIRT2544668	hsa-miR-4684-5p	CLIP-seq
MIRT1041428	hsa-miR-4691-3p	CLIP-seq
MIRT1041429	hsa-miR-4695-5p	CLIP-seq
MIRT2008684	hsa-miR-4696	CLIP-seq
MIRT2008685	hsa-miR-4722-5p	CLIP-seq
MIRT2241115	hsa-miR-4742-5p	CLIP-seq
MIRT1041430	hsa-miR-4768-3p	CLIP-seq
MIRT1041432	hsa-miR-485-5p	CLIP-seq
MIRT2008686	hsa-miR-508-5p	CLIP-seq
MIRT1041433	hsa-miR-510	CLIP-seq
MIRT1041434	hsa-miR-520f	CLIP-seq
MIRT2544669	hsa-miR-548c-3p	CLIP-seq
MIRT2544670	hsa-miR-593	CLIP-seq
MIRT2008687	hsa-miR-612	CLIP-seq
MIRT2008688	hsa-miR-661	CLIP-seq
MIRT2008689	hsa-miR-665	CLIP-seq
MIRT2008690	hsa-miR-766	CLIP-seq
MIRT2544671	hsa-miR-876-3p	CLIP-seq
MIRT1041437	hsa-miR-92a	CLIP-seq
MIRT1041438	hsa-miR-92b	CLIP-seq
MIRT2544659	hsa-miR-10a	CLIP-seq
MIRT2544660	hsa-miR-10b	CLIP-seq
MIRT1041408	hsa-miR-1227	CLIP-seq
MIRT2008673	hsa-miR-1285	CLIP-seq
MIRT1041412	hsa-miR-25	CLIP-seq
MIRT2544661	hsa-miR-3065-5p	CLIP-seq
MIRT2008676	hsa-miR-3187-5p	CLIP-seq
MIRT1041413	hsa-miR-32	CLIP-seq
MIRT2544662	hsa-miR-323-5p	CLIP-seq
MIRT2544663	hsa-miR-339-5p	CLIP-seq
MIRT2008677	hsa-miR-3613-3p	CLIP-seq
MIRT2544664	hsa-miR-3622b-5p	CLIP-seq
MIRT1041414	hsa-miR-363	CLIP-seq
MIRT1041415	hsa-miR-3664-3p	CLIP-seq
MIRT1041416	hsa-miR-367	CLIP-seq
MIRT2008678	hsa-miR-371-5p	CLIP-seq
MIRT2008679	hsa-miR-371b-5p	CLIP-seq
MIRT1041419	hsa-miR-3929	CLIP-seq
MIRT2544665	hsa-miR-3945	CLIP-seq
MIRT2544666	hsa-miR-4253	CLIP-seq
MIRT1041421	hsa-miR-4325	CLIP-seq
MIRT1041422	hsa-miR-4419b	CLIP-seq
MIRT2544667	hsa-miR-4421	CLIP-seq
MIRT2008680	hsa-miR-4432	CLIP-seq
MIRT1041423	hsa-miR-4433	CLIP-seq
MIRT1041424	hsa-miR-4459	CLIP-seq
MIRT1041425	hsa-miR-4478	CLIP-seq
MIRT2008682	hsa-miR-451b	CLIP-seq
MIRT1041427	hsa-miR-4649-3p	CLIP-seq
MIRT2544668	hsa-miR-4684-5p	CLIP-seq
MIRT1041428	hsa-miR-4691-3p	CLIP-seq
MIRT1041429	hsa-miR-4695-5p	CLIP-seq
MIRT2008684	hsa-miR-4696	CLIP-seq
MIRT2241115	hsa-miR-4742-5p	CLIP-seq
MIRT1041430	hsa-miR-4768-3p	CLIP-seq
MIRT1041432	hsa-miR-485-5p	CLIP-seq
MIRT2008686	hsa-miR-508-5p	CLIP-seq
MIRT1041433	hsa-miR-510	CLIP-seq
MIRT1041434	hsa-miR-520f	CLIP-seq
MIRT2544669	hsa-miR-548c-3p	CLIP-seq
MIRT2544670	hsa-miR-593	CLIP-seq
MIRT2008687	hsa-miR-612	CLIP-seq
MIRT2008688	hsa-miR-661	CLIP-seq
MIRT2008690	hsa-miR-766	CLIP-seq
MIRT2544671	hsa-miR-876-3p	CLIP-seq
MIRT1041437	hsa-miR-92a	CLIP-seq
MIRT1041438	hsa-miR-92b	CLIP-seq

Show/Hide all(47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001772	Component	Immunological synapse	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002281	Process	Macrophage activation involved in immune response	IEA
GO:0002519	Process	Natural killer cell tolerance induction	IMP	25578313
GO:0002652	Process	Regulation of tolerance induction dependent upon immune response	IEA
GO:0002826	Process	Negative regulation of T-helper 1 type immune response	IEA
GO:0002859	Process	Negative regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IEA
GO:0005515	Function	Protein binding	IPI	25363763, 32296183
GO:0005769	Component	Early endosome	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0009986	Component	Cell surface	IDA	25363763
GO:0010629	Process	Negative regulation of gene expression	IMP	25578313
GO:0016021	Component	Integral component of membrane	IEA
GO:0030054	Component	Cell junction	IEA
GO:0030886	Process	Negative regulation of myeloid dendritic cell activation	IMP	22842346
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IMP	22842346
GO:0032687	Process	Negative regulation of interferon-alpha production	IDA	26492563
GO:0032689	Process	Negative regulation of interferon-gamma production	IDA	26492563
GO:0032703	Process	Negative regulation of interleukin-2 production	IDA	26492563
GO:0032712	Process	Negative regulation of interleukin-3 production	IDA	26492563
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IMP	25578313
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032729	Process	Positive regulation of interferon-gamma production	IEA
GO:0032732	Process	Positive regulation of interleukin-1 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	IMP	25578313
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	18006747
GO:0032815	Process	Negative regulation of natural killer cell activation	IEA
GO:0034138	Process	Toll-like receptor 3 signaling pathway	IEA
GO:0034154	Process	Toll-like receptor 7 signaling pathway	IEA
GO:0034162	Process	Toll-like receptor 9 signaling pathway	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0043032	Process	Positive regulation of macrophage activation	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0060135	Process	Maternal process involved in female pregnancy	IDA	25578313
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071656	Process	Negative regulation of granulocyte colony-stimulating factor production	IDA	26492563
GO:1900425	Process	Negative regulation of defense response to bacterium	IEA
GO:1900426	Process	Positive regulation of defense response to bacterium	IEA
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	IEA
GO:2000521	Process	Negative regulation of immunological synapse formation	IEA
GO:2001189	Process	Negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IDA	26492563

MIM	HGNC	e!Ensembl
606652	18437	ENSG00000135077

Protein

UniProt ID

Q8TDQ0

Protein name

Hepatitis A virus cellular receptor 2 (HAVcr-2) (T-cell immunoglobulin and mucin domain-containing protein 3) (TIMD-3) (T-cell immunoglobulin mucin receptor 3) (TIM-3) (T-cell membrane protein 3) (CD antigen CD366)

Protein function

Cell surface receptor implicated in modulating innate and adaptive immune responses. Generally accepted to have an inhibiting function. Reports on stimulating functions suggest that the activity may be influenced by the cellular context and/or t

PDB

5DZL , 5F71 , 6DHB , 6TXZ , 7KQL , 7M3Y , 7M3Z , 7M41 , 8HGJ , 8TBB , 8TFT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	21 → 130	Immunoglobulin V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in T-helper type 1 (Th1) lymphocytes. Expressed on regulatory T (Treg) cells after TCR stimulation. Expressed in dendritic cells and natural killer (NK) cells. Expressed in epithelial tissues. Expression is increased on CD4+

Sequence

MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPV
FECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMND
EKFNLKLVIKPAKVTPAPTRQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLA
NELRDSRLANDLRDSGATIRIGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLI
SLANLPPSGLANAVAEGIRSEENIYTIEENVYEVEEPNEYYCYVSSRQQPSQPLGCRFAM
P

Sequence length

301

Interactions

View interactions

	KEGG
	Efferocytosis

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Hemophagocytic lymphohistiocytosis	Hemophagocytic Lymphohistiocytosis, Familial, 1	rs796065024, rs796065025, rs796065026, rs777759523, rs121434352, rs201908137, rs121434353, rs121434354, rs483352901, rs104893996, rs121918540, rs1599398298, rs121918541, rs1599395085, rs2146217813 View all (66 more)	30374066
Hypofibrinogenemia	Hypofibrinogenemia	rs121913087, rs121913088, rs587776837, rs121909616, rs121909625, rs121909608, rs121909607, rs146387238, rs1578795296, rs1214070111, rs776817952, rs762964798, rs121909606, rs1414035000, rs1310452604

Show/Hide Unknown Diseases (3)

Disease term	Disease name	References	Source
Unknown
Subcutaneous panniculitis-like t-cell lymphoma	Subcutaneous panniculitis-like T-cell lymphoma	30374066	ClinVar
Subcutaneous Panniculitis-Like T-Cell Lymphoma	subcutaneous panniculitis-like T-cell lymphoma		GenCC
Oligodendroglioma	Oligodendroglioma		GWAS

Show/Hide Text Mining Associations (227)

Disease Name	Relationship Type	References
Associations from Text Mining
Abortion Spontaneous	Associate	40068377
Acrocephalosyndactylia	Associate	37118659
Acute On Chronic Liver Failure	Associate	35502507
Adenocarcinoma	Associate	35228614, 35708739, 35800186, 36759392
Adenocarcinoma of Lung	Associate	26851185, 35476781, 35836920, 36197217, 36759392, 36865498, 37131252, 37536668
Adenomyosis	Stimulate	32319832
Anemia	Associate	37479109
Anxiety Disorders	Associate	38016492
Arteriosclerosis Obliterans	Stimulate	32467985
Arteriosclerosis Obliterans	Associate	35757718
Arthritis Infectious	Associate	36190378
Arthritis Psoriatic	Inhibit	39662827
Arthritis Rheumatoid	Associate	30106887
Asthma	Associate	28865412, 35029177
Asthma	Stimulate	30644695
Astrocytoma	Associate	33244787
Ataxia Telangiectasia	Associate	31227543, 38183111
Atherosclerosis	Inhibit	32467985
Atherosclerosis	Associate	33015716
Atrioventricular Block	Associate	39354406
Autoimmune Diseases	Associate	16754722, 22438246, 23388728, 23526963, 26076826, 28974109, 31644615, 32319832, 39456777
Bacterial Infections	Associate	26486200
Biliary Tract Neoplasms	Associate	32878426
Bipolar Disorder	Associate	28074937
Bone Marrow Diseases	Stimulate	24833097
Brain Neoplasms	Associate	34670827, 37586773
Breast Neoplasms	Associate	27248321, 29983831, 30759303, 31292534, 32616706, 36271406, 36388159, 38069525
Breast Neoplasms	Stimulate	36763585
Carcinogenesis	Associate	31661141
Carcinoma	Associate	37926435
Carcinoma Basal Cell	Associate	38101862
Carcinoma Hepatocellular	Associate	22505239, 23526963, 24867713, 27034168, 28033288, 29666149, 29706626, 31927532, 32170378, 34249476, 34777920, 34808386, 35592706, 36042180, 37077908, 39330965, 39838375 View all (2 more)
Carcinoma Non Small Cell Lung	Associate	23359271, 29526824, 31053602, 33883177, 35019173, 35318258, 35833140, 36159860, 36759392, 37453674
Carcinoma Ovarian Epithelial	Associate	37868997
Carcinoma Pancreatic Ductal	Stimulate	37347110
Carcinoma Renal Cell	Associate	22505239, 26715281, 28112366, 29553498, 30630458, 32277125, 32396851, 33389015, 34545095, 34867961, 36768365
Carcinoma Squamous Cell	Associate	28423034, 32139873, 35799269, 36759392
Cardiovascular Diseases	Associate	34101055
Cell Transformation Neoplastic	Inhibit	32616706
Cerebral Hemorrhage	Associate	23665438
Chemical and Drug Induced Liver Injury	Associate	37828574
Cholangiocarcinoma	Associate	35597869
Chordoma	Associate	31197461
Choriocarcinoma	Associate	36875956
Clear cell metastatic renal cell carcinoma	Associate	38060202
Colonic Neoplasms	Associate	32468013
Colorectal Neoplasms	Associate	26008981, 26339368, 29770915, 31726050, 31921188, 32265897, 32509862, 33229508, 33338327, 34996408, 36968142, 37178411, 39739032
Colorectal Neoplasms	Stimulate	28035413, 30081950, 32393998
Communicable Diseases	Associate	22323453, 35464400
Congenital disorder of glycosylation type 1C	Associate	34625514
COVID 19	Associate	32983106, 33060840, 33145962, 33548481, 33937096, 34439887, 35250975, 35908408, 36305225, 40005306
Crohn Disease	Associate	25071071
Cystic Disease Of Lung	Associate	24477913
Cystic Fibrosis	Stimulate	21263071
Dermatitis Atopic	Associate	35967337
Dermatomyositis	Stimulate	38153165
Diabetes Mellitus	Associate	27182056, 33123595, 35966054, 37082729
Diabetes Mellitus	Inhibit	38030055
Diabetes Mellitus Type 1	Associate	35966054
Diabetes Mellitus Type 2	Inhibit	27182056
Diabetes Mellitus Type 2	Associate	33123595, 35464400, 37082729
Disease	Stimulate	31292534
Disease	Associate	32983106
Disease Progression	Associate	32203221
Dissection Thoracic Aorta	Associate	38420822
Drug Hypersensitivity	Associate	19566956
Drug Related Side Effects and Adverse Reactions	Inhibit	28475007
Drug Related Side Effects and Adverse Reactions	Associate	32373555
Endometrial Neoplasms	Associate	30926882, 35804040, 36199963
Endometriosis	Associate	29511377, 32231038, 36983021
Esophageal Neoplasms	Associate	27577071, 33323552
Esophageal Squamous Cell Carcinoma	Associate	30128737, 31882943, 34625514
Essential Tremor	Associate	27990849
Exanthema	Associate	36159840
Fibrosis	Associate	31678004
Fibrous Dysplasia Polyostotic	Inhibit	19480659
Gallbladder Neoplasms	Associate	37828574
Gastrointestinal Neoplasms	Associate	35094125
Gastrointestinal Stromal Tumors	Associate	29526824, 33681387
GATA2 Deficiency	Associate	25520133
Genetic Diseases Inborn	Associate	38077348
Gestational Trophoblastic Disease	Associate	36875956
Glioblastoma	Associate	28880903, 33800561, 35558067, 35628503, 35857445, 37884280, 38057698, 39513882
Glioma	Associate	31436247, 33800561, 34923867, 35216164, 35857445, 39840558, 40696074
Glioma	Stimulate	35198632
Glomerulonephritis Membranous	Associate	37075987
Glycogen Storage Disease Type IV	Associate	33244787
Graft vs Host Disease	Associate	28478120
Graves Disease	Inhibit	29974826
Graves Ophthalmopathy	Associate	29974826
Head and Neck Neoplasms	Associate	28408386, 35140722
Hematologic Neoplasms	Associate	38640253
Hemorrhage	Inhibit	28974109
Hepatitis Autoimmune	Associate	28257599
Hepatitis B	Associate	24867713, 27034168, 28033288, 30939292, 34249476, 39456777
Hepatitis B Chronic	Associate	29666149, 30939292
Hepatitis C	Associate	23388728, 34930041
Hepatitis C Chronic	Associate	32994477
HIV Infections	Associate	22438246, 22792231, 25180498, 25685816, 29518102, 31578868, 31941771, 34672108
HIV Infections	Stimulate	23029209, 26486200, 33832435, 34149690
HIV Infections	Inhibit	23866914, 29731749, 31827152
Hodgkin Disease	Associate	34584203, 34941990
Hypertension Portal	Stimulate	34930041
Idiopathic Noncirrhotic Portal Hypertension	Associate	28033288, 31678004, 34930041
Immune System Diseases	Associate	32231038
Immuno hemolytic anemia	Associate	18052965
Infections	Associate	22438246, 31678004, 33548481, 34358561
Infections	Stimulate	23029209
Inflammation	Associate	24477913, 26482613, 27182056, 27990849, 29731749, 30459127, 32345786, 32467985, 34439887, 35029177, 37934691
Inflammation	Inhibit	30106887
Inflammation	Stimulate	35502507
Influenza Human	Associate	31578868
Insulin Resistance	Associate	30759303
Kidney Neoplasms	Associate	27549193
Leukemia	Associate	23554257, 27424989, 30292745, 36545697, 36622326, 36960055, 37919606, 38022614
Leukemia Biphenotypic Acute	Inhibit	39456930
Leukemia Lymphocytic Chronic B Cell	Associate	29276179, 32986360, 35193595
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	29925907, 31695700, 36622326, 37919606
Leukemia Myeloid Acute	Associate	22323453, 23554257, 24855276, 25400771, 25886742, 27506934, 29720577, 29843224, 29908544, 29946192, 31291985, 33094319, 33463129, 33758676, 34129052 View all (11 more)
Leukemia Myeloid Acute	Stimulate	38536023
Liver Cirrhosis	Associate	32994477
Liver Cirrhosis Biliary	Associate	37915081
Lung Diseases	Stimulate	34867961
Lung Diseases Fungal	Associate	38153165
Lung Injury	Inhibit	34483230
Lung Neoplasms	Associate	25520133, 34670827, 35836920, 36865498
Lung Neoplasms	Stimulate	34510768
Lupus Erythematosus Systemic	Associate	18052965, 33641540, 37802602
Lupus Erythematosus Systemic	Stimulate	26076826, 34101055
Lymphatic Metastasis	Associate	24339967, 26339368, 26464703, 27248321, 28035413, 32506804
Lymphatic Metastasis	Stimulate	36865498
Lymphohistiocytosis Hemophagocytic	Associate	34535012, 36503528, 37479109, 38077348
Lymphoma	Associate	20176801, 31672704, 33015716
Lymphoma B Cell	Associate	20176801, 24569779
Lymphoma Follicular	Associate	37899130
Lymphoma Large B Cell Diffuse	Stimulate	24833097, 33664848
Lymphoma Large B Cell Diffuse	Associate	28281555, 30572564, 32079690, 33178839, 33721055, 33787861, 34645670, 35675517
Lymphoma Mantle Cell	Associate	20656318
Lymphoma T Cell	Associate	36171125
Lymphoma T Cell Peripheral	Associate	31672704
Malaria	Associate	32983106
Melanoma	Associate	17096021, 22205715, 24343228, 24795354, 31747929, 33015716, 36433984, 39716918
Melanoma	Stimulate	20819923
Microsatellite Instability	Stimulate	31530839
Mucor infection	Associate	36305225
Multiple Myeloma	Associate	33257767, 39308517
Multiple Myeloma	Stimulate	36605214
Multiple Sclerosis	Associate	16754722, 20176801, 31134049
Multiple Sclerosis Chronic Progressive	Inhibit	31134049
Myelodysplastic Syndromes	Associate	24855276, 27565576, 31756785, 34543390, 36282797
Nasal Polyps	Associate	39347549
Nasopharyngeal Carcinoma	Associate	28871094
Nasopharyngeal Carcinoma	Stimulate	36913701
Neoplasm Metastasis	Associate	20811886, 23335978, 25119597, 27706678, 28035413, 34021032, 34104542, 34510768, 37828574
Neoplasm Metastasis	Stimulate	28671022, 36096531
Neoplasm Metastasis	Inhibit	37586773
Neoplasms	Associate	17096021, 20656318, 20811886, 20819923, 22205715, 22323453, 22505239, 23335978, 23359271, 23526963, 23554257, 23886204, 24339967, 24343228, 24667641 View all (83 more)
Neoplasms	Stimulate	24833097, 27577071
Neoplasms Squamous Cell	Associate	20656318
Neuroblastoma	Associate	37130627
Neurofibrosarcoma	Associate	28475007
Non Muscle Invasive Bladder Neoplasms	Stimulate	29860605
Non Muscle Invasive Bladder Neoplasms	Associate	33323544, 37452272
Obesity	Associate	33123595
Oropharyngeal Neoplasms	Associate	37175405
Osteoarthritis	Inhibit	27044824
Osteosarcoma	Associate	27706678, 33959121, 36519392, 37858131
Osteosarcoma	Stimulate	28671022
Ovarian Diseases	Associate	32334621
Ovarian Neoplasms	Stimulate	23526963
Ovarian Neoplasms	Associate	26482613, 33887301, 35186171, 35326415, 37876933
Ovarian Neoplasms	Inhibit	39972314
Pancreatic Neoplasms	Associate	28241889, 38132831
Pancreatitis	Associate	30459127
Panniculitis	Associate	36171125
Panniculitis Lupus Erythematosus	Associate	36171125
Papilloma	Associate	38193541
Paralysis	Associate	33937096
Paraneoplastic Syndromes	Associate	26008981
Paraparesis Tropical Spastic	Associate	33767694
pediatric multisystem inflammatory disease COVID 19 related	Associate	34914824
Periodontitis	Associate	34502071
Peripheral Arterial Disease	Stimulate	40761788
Pleural Effusion	Associate	31833092, 35811063
Polyendocrinopathies Autoimmune	Associate	39456777
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	36901957
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	26413815, 27565576
Prodromal Symptoms	Associate	32509862
Prostatic Hyperplasia	Associate	26993768
Prostatic Neoplasms	Associate	23886204, 25119597, 26289091, 28681697, 28827755, 28952222, 33569050, 33934205, 36124532
Prostatic Neoplasms Castration Resistant	Inhibit	28827755
Psoriasis	Associate	22294262
Purpura Thrombocytopenic Idiopathic	Associate	28974109
Respiratory Tract Diseases	Associate	34535012
Rickettsia Infections	Associate	33015716
Salivary Duct Calculi	Associate	32292502
Sarcoidosis	Associate	19480659
Sarcoma	Associate	31263176, 32792357
Sepsis	Associate	35502507
Severe Combined Immunodeficiency Autosomal Recessive T Cell Negative B Cell Positive NK Cell Positive	Associate	35464400
Shock	Associate	36402952
Skull Base Neoplasms	Associate	31197461
Small Cell Lung Carcinoma	Associate	34228218
Squamous Cell Carcinoma of Head and Neck	Associate	28466780, 31089395, 33396515, 33995377, 34729919, 35794182
Status Asthmaticus	Stimulate	30644695
Still's Disease Adult Onset	Associate	32698838
Stomach Neoplasms	Associate	20811886, 24339967, 26464703, 32858135, 33575321, 33611641, 34367732, 34725458, 35664061, 36002752, 37798754
Stomach Neoplasms	Stimulate	36680216
Subcutaneous panniculitis like T cell lymphoma	Associate	30792187, 34535012, 36171125, 36503528, 36927968, 37479109, 38077348
Tarlov Cysts	Associate	37464189
Thymic epithelial tumor	Associate	28771603
Thyroid cancer medullary	Associate	37464189
Thyroid Neoplasms	Associate	25701326, 35574031, 37501393
Thyroiditis Autoimmune	Stimulate	25880730
Thyroiditis Autoimmune	Associate	37501789
Toxoplasmosis Ocular	Associate	39277179
Triple Negative Breast Neoplasms	Associate	33823818, 37924153
Tuberculosis	Associate	26486200, 35811063
Tuberculosis Pulmonary	Associate	32345786
Turcot syndrome	Associate	30926882
Urethral Neoplasms	Associate	37017991
Urinary Bladder Neoplasms	Associate	31174611, 40367012
Uterine Cervical Dysplasia	Associate	32139873
Uterine Cervical Neoplasms	Associate	23335978, 31661141, 33306195, 35435763
Virus Diseases	Associate	23526963, 25180498, 29731749
Virus Diseases	Inhibit	26339368
West Nile Fever	Associate	24642562

HAVCR2 (hepatitis A virus cellular receptor 2)