ATP1A1-AS1 (ATP1A1 antisense RNA 1)

Gene Gene information from NCBI Gene database.
Gene Other IDs Protein
Entrez ID 84852
Gene name ATP1A1 antisense RNA 1
Gene symbol ATP1A1-AS1
Synonyms (NCBI Gene)
ATP1A1OSC1orf203
Chromosome 1
Chromosome location 1p13.1
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Other IDs Protein
MIM HGNC e!Ensembl
618305 28262 ENSG00000203865
Protein Protein information from UniProt database.
Gene Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5TC04
Protein name Putative uncharacterized protein ATP1A1-AS1 (ATP1A1 antisense RNA 1) (ATP1A1 antisense gene protein 1) (ATP1A1 opposite strand protein)
Family and domains
Sequence 
MAHFKDDLQTNVEIIPGESAPRKESPRPPAPPSSAAGVGGCSNHSPSVQESPLSPPALAQ
LGSAQQPSMRTELSFSEKKDTMIIWQITITVWCQR
Sequence length 95
Interactions View interactions