GALR3 (galanin receptor 3)

Gene

• Entrez ID: 8484
• Gene name: Galanin receptor 3
• Gene symbol: GALR3
• Synonyms (NCBI Gene): -
• Chromosome: 22
• Chromosome location: 22q13.1
• Summary: The neuropeptide galanin modulates a variety of physiologic processes including cognition/memory, sensory/pain processing, hormone secretion, and feeding behavior. The human galanin receptors are G protein-coupled receptors that functionally couple to th

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030067	hsa-miR-26b-5p	Microarray	19088304

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004966	Function	Galanin receptor activity	IBA
GO:0004966	Function	Galanin receptor activity	IDA	9832121, 24517231
GO:0004966	Function	Galanin receptor activity	IEA
GO:0004966	Function	Galanin receptor activity	TAS	9722565
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9722565
GO:0005929	Component	Cilium	IDA	28154160
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IDA	9832121
GO:0007218	Process	Neuropeptide signaling pathway	TAS	9722565
GO:0007268	Process	Chemical synaptic transmission	TAS	9722565
GO:0007611	Process	Learning or memory	TAS	9722565
GO:0007631	Process	Feeding behavior	TAS	9722565
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9722565
GO:0017046	Function	Peptide hormone binding	IDA	24517231
GO:0017046	Function	Peptide hormone binding	IPI	9832121
GO:0045202	Component	Synapse	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24517231
GO:0090663	Process	Galanin-activated signaling pathway	IBA
GO:0090663	Process	Galanin-activated signaling pathway	IDA	9832121
GO:0097730	Component	Non-motile cilium	IEA

Other IDs

• MIM: 603692
• HGNC: 4134
• e!Ensembl: ENSG00000128310

Protein

• UniProt ID: O60755
• Protein name: Galanin receptor type 3 (GAL3-R) (GALR-3)
• Protein function: Receptor for the hormone galanin (PubMed:25691535). Receptor for the hormone spexin-1 (PubMed:24517231).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	34 → 291	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MADAQNISLDSPGSVGAVAVPVVFALIFLLGTVGNGLVLAVLLQPGPSAWQEPGSTTDLF
  ILNLAVADLCFILCCVPFQATIYTLDAWLFGALVCKAVHLLIYLTMYASSFTLAAVSVDR
  YLAVRHPLRSRALRTPRNARAAVGLVWLLAALFSAPYLSYYGTVRYGALELCVPAWEDAR
  RRALDVATFAAGYLLPVAVVSLAYGRTLRFLWAAVGPAGAAAAEARRRATGRAGRAMLAV
  AALYALCWGPHHALILCFWYGRFAFSPATYACRLASHCLAYANSCLNPLVYALASRHFRA
  RFRRLWPCGRRRRHRARRALRRVRPASSGPPGCPGDARPSGRLLAGGGQGPEPREGPVHG
  GEAARGPE

• Sequence length: 368

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events