GALR3 (galanin receptor 3)

Gene

• Entrez ID: 8484
• Gene name: Galanin receptor 3
• Gene symbol: GALR3
• Synonyms (NCBI Gene): -
• Chromosome: 22
• Chromosome location: 22q13.1
• Summary: The neuropeptide galanin modulates a variety of physiologic processes including cognition/memory, sensory/pain processing, hormone secretion, and feeding behavior. The human galanin receptors are G protein-coupled receptors that functionally couple to th

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030067	hsa-miR-26b-5p	Microarray	19088304

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004966	Function	Galanin receptor activity	IBA	21873635
GO:0004966	Function	Galanin receptor activity	IDA	9832121, 24517231
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005929	Component	Cilium	IDA	28154160
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IDA	9832121
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007194	Process	Negative regulation of adenylate cyclase activity	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA	21873635
GO:0007268	Process	Chemical synaptic transmission	TAS	9722565
GO:0007611	Process	Learning or memory	TAS	9722565
GO:0007631	Process	Feeding behavior	TAS	9722565
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA	21873635
GO:0016021	Component	Integral component of membrane	TAS	9722565
GO:0017046	Function	Peptide hormone binding	IDA	24517231
GO:0017046	Function	Peptide hormone binding	IPI	9832121
GO:0045202	Component	Synapse	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24517231
GO:0090663	Process	Galanin-activated signaling pathway	IDA	9832121
GO:0097730	Component	Non-motile cilium	IEA

Other IDs

• MIM: 603692
• HGNC: 4134
• e!Ensembl: ENSG00000128310

Protein

• UniProt ID: O60755
• Protein name: Galanin receptor type 3 (GAL3-R) (GALR-3)
• Protein function: Receptor for the hormone galanin (PubMed:25691535). Receptor for the hormone spexin-1 (PubMed:24517231).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	34 → 291	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MADAQNISLDSPGSVGAVAVPVVFALIFLLGTVGNGLVLAVLLQPGPSAWQEPGSTTDLF
  ILNLAVADLCFILCCVPFQATIYTLDAWLFGALVCKAVHLLIYLTMYASSFTLAAVSVDR
  YLAVRHPLRSRALRTPRNARAAVGLVWLLAALFSAPYLSYYGTVRYGALELCVPAWEDAR
  RRALDVATFAAGYLLPVAVVSLAYGRTLRFLWAAVGPAGAAAAEARRRATGRAGRAMLAV
  AALYALCWGPHHALILCFWYGRFAFSPATYACRLASHCLAYANSCLNPLVYALASRHFRA
  RFRRLWPCGRRRRHRARRALRRVRPASSGPPGCPGDARPSGRLLAGGGQGPEPREGPVHG
  GEAARGPE

• Sequence length: 368

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Unknown
Disease term	Disease name	Evidence	References	Source
Mental depression	Major Depressive Disorder		27940914	ClinVar

Associations from Text Mining
Disease Name	Relationship Type	References
Alcoholism	Associate	17083333
Anxiety	Associate	24116939, 24706871
Colorectal Neoplasms	Associate	35409094
Colorectal Neoplasms	Stimulate	36551197
Depressive Disorder	Associate	24116939, 24706871
Ganglioneuroma	Inhibit	11857022
Glioma	Associate	32265844
Klatskin Tumor	Associate	37443714
Mood Disorders	Associate	24116939
Neoplasms	Inhibit	19276245
Neoplasms	Associate	37443714
Neuroblastoma	Stimulate	11857022
Obesity	Associate	37658762
Polycystic Ovary Syndrome	Stimulate	37658762
Substance Related Disorders	Associate	24116939