Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8484
Gene name Gene Name - the full gene name approved by the HGNC.	Galanin receptor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GALR3
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q13.1
Summary Summary of gene provided in NCBI Entrez Gene.	The neuropeptide galanin modulates a variety of physiologic processes including cognition/memory, sensory/pain processing, hormone secretion, and feeding behavior. The human galanin receptors are G protein-coupled receptors that functionally couple to th

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030067	hsa-miR-26b-5p	Microarray	19088304

Show/Hide all(25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004966	Function	Galanin receptor activity	IBA
GO:0004966	Function	Galanin receptor activity	IDA	9832121, 24517231
GO:0004966	Function	Galanin receptor activity	IEA
GO:0004966	Function	Galanin receptor activity	TAS	9722565
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9722565
GO:0005929	Component	Cilium	IDA	28154160
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IDA	9832121
GO:0007218	Process	Neuropeptide signaling pathway	TAS	9722565
GO:0007268	Process	Chemical synaptic transmission	TAS	9722565
GO:0007611	Process	Learning or memory	TAS	9722565
GO:0007631	Process	Feeding behavior	TAS	9722565
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9722565
GO:0017046	Function	Peptide hormone binding	IDA	24517231
GO:0017046	Function	Peptide hormone binding	IPI	9832121
GO:0045202	Component	Synapse	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24517231
GO:0090663	Process	Galanin-activated signaling pathway	IBA
GO:0090663	Process	Galanin-activated signaling pathway	IDA	9832121
GO:0097730	Component	Non-motile cilium	IEA

MIM	HGNC	e!Ensembl
603692	4134	ENSG00000128310

Protein

UniProt ID

O60755

Protein name

Galanin receptor type 3 (GAL3-R) (GALR-3)

Protein function

Receptor for the hormone galanin (PubMed:25691535). Receptor for the hormone spexin-1 (PubMed:24517231).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	34 → 291	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MADAQNISLDSPGSVGAVAVPVVFALIFLLGTVGNGLVLAVLLQPGPSAWQEPGSTTDLF
ILNLAVADLCFILCCVPFQATIYTLDAWLFGALVCKAVHLLIYLTMYASSFTLAAVSVDR
YLAVRHPLRSRALRTPRNARAAVGLVWLLAALFSAPYLSYYGTVRYGALELCVPAWEDAR
RRALDVATFAAGYLLPVAVVSLAYGRTLRFLWAAVGPAGAAAAEARRRATGRAGRAMLAV
AALYALCWGPHHALILCFWYGRFAFSPATYACRLASHCLAYANSCLNPLVYALASRHFRA
RFRRLWPCGRRRRHRARRALRRVRPASSGPPGCPGDARPSGRLLAGGGQGPEPREGPVHG
GEAARGPE

Sequence length

368

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Peptide ligand-binding receptors G alpha (i) signalling events

GALR3 (galanin receptor 3)