Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84839
Gene name Gene Name - the full gene name approved by the HGNC.
Retina and anterior neural fold homeobox 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RAX2
Synonyms (NCBI Gene) Gene synonyms aliases
ARMD6, CORD11, QRX, RAXL1, RP95
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a homeodomain-containing protein that plays a role in eye development. Mutation of this gene causes age-related macular degeneration type 6, an eye disorder resulting in accumulations of protein and lipid beneath the retinal pigment epit
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121908280 C>A,G,T Pathogenic Coding sequence variant, missense variant
rs121908281 C>G Pathogenic Coding sequence variant, missense variant
rs141804618 C>T Likely-benign, conflicting-interpretations-of-pathogenicity Synonymous variant, coding sequence variant
rs398124431 G>A,T Pathogenic Stop gained, coding sequence variant, missense variant
rs549932754 ->GGGCCC Pathogenic Inframe insertion, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1293292 hsa-miR-122 CLIP-seq
MIRT1293293 hsa-miR-1267 CLIP-seq
MIRT1293294 hsa-miR-149 CLIP-seq
MIRT1293295 hsa-miR-1976 CLIP-seq
MIRT1293296 hsa-miR-2110 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 15028672
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610362 18286 ENSG00000173976
Protein
UniProt ID Q96IS3
Protein name Retina and anterior neural fold homeobox protein 2 (Q50-type retinal homeobox protein) (Retina and anterior neural fold homeobox-like protein 1)
Protein function May be involved in modulating the expression of photoreceptor specific genes. Binds to the Ret-1 and Bat-1 element within the rhodopsin promoter.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 28 84 Homeodomain Domain
Sequence
MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREEL
AAKVHLPEVRVQVWFQNRRAKWRR
QERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEP
WLGPGPPAVPGLPRLLGPGPGLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQALDRA
WPPA
Sequence length 184
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Cone-rod dystrophy cone-rod dystrophy 11 rs121908281, rs886041039 N/A
retinal dystrophy Retinal dystrophy rs886041039, rs76076446 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Macular Degeneration macular degeneration N/A N/A ClinVar
Retinitis Pigmentosa Retinitis pigmentosa 95, retinitis pigmentosa 95 N/A N/A ClinVar, GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Cone Rod Dystrophies Associate 25789692
Genetic Diseases Inborn Associate 30377383
Heart Diseases Associate 25789692
Retinal Diseases Associate 30377383
Retinal Dystrophies Associate 25789692
Retinitis Pigmentosa Associate 30377383, 38507880