Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	84830
Gene name Gene Name - the full gene name approved by the HGNC.	Androgen dependent TFPI regulating protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADTRP
Synonyms (NCBI Gene) Gene synonyms aliases	AIG1L, C6orf105, dJ413H6.1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p24.1

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IMP	28341552
GO:0002686	Process	Negative regulation of leukocyte migration	IMP	28341552
GO:0003332	Process	Negative regulation of extracellular matrix constituent secretion	IMP	28341552
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005901	Component	Caveola	IDA	21868574
GO:0006629	Process	Lipid metabolic process	IEA
GO:0009986	Component	Cell surface	IDA	21868574
GO:0010628	Process	Positive regulation of gene expression	IMP	21868574, 28341552
GO:0012505	Component	Endomembrane system	IBA
GO:0016020	Component	Membrane	IDA	27018888
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016787	Function	Hydrolase activity	IMP	27018888
GO:0030195	Process	Negative regulation of blood coagulation	IMP	21868574
GO:0042758	Process	Long-chain fatty acid catabolic process	IMP	27018888
GO:0050709	Process	Negative regulation of protein secretion	IMP	28341552
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	28341552
GO:0071383	Process	Cellular response to steroid hormone stimulus	IEP	21868574
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IMP	28341552
GO:1903038	Process	Negative regulation of leukocyte cell-cell adhesion	IMP	28341552
GO:2000402	Process	Negative regulation of lymphocyte migration	IMP	28341552

MIM	HGNC	e!Ensembl
614348	21214	ENSG00000111863

Protein

UniProt ID

Q96IZ2

Protein name

Androgen-dependent TFPI-regulating protein (Fatty acid esters of hydroxy fatty acids hydrolase ADTRP) (FAHFA hydrolase ADTRP) (EC 3.1.-.-)

Protein function

Hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), but not other major classes of lipids (PubMed:27018888). Show a preference for FAHFAs with branching distal from the carboxylate head group of the lipids (PubMed:27018888).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04750	Far-17a_AIG1	5 → 216	FAR-17a/AIG1-like protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in cultured endothelial cells and in placenta. {ECO:0000269|PubMed:21868574}.

Sequence

MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGV
TCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDT
VIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTW
VYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK

Sequence length

230

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Colorectal Cancer	Colorectal cancer	N/A	N/A	GWAS
Neuroticism	Neuroticism	N/A	N/A	GWAS

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Asymptomatic Diseases	Associate	25928384
Atherosclerosis	Associate	25595457, 28341552, 28645652
Cardiovascular Diseases	Associate	28645652
Cerebral Arterial Diseases	Associate	27235449
Coronary Artery Disease	Associate	22952750, 24573017, 25595457, 25928384, 26375920, 27235449, 28341552, 28645652, 32790694, 36435092
Disease	Associate	36435092
Hyperuricemia	Associate	25928384
Leiomyoma	Associate	28715450
Obesity	Inhibit	25595457

ADTRP (androgen dependent TFPI regulating protein)