ADTRP (androgen dependent TFPI regulating protein)

Gene

• Entrez ID: 84830
• Gene name: Androgen dependent TFPI regulating protein
• Gene symbol: ADTRP
• Synonyms (NCBI Gene): AIG1L, C6orf105, dJ413H6.1
• Chromosome: 6
• Chromosome location: 6p24.1

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	28341552
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IMP	28341552
GO:0002686	Process	Negative regulation of leukocyte migration	IMP	28341552
GO:0003332	Process	Negative regulation of extracellular matrix constituent secretion	IMP	28341552
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005901	Component	Caveola	IDA	21868574
GO:0009986	Component	Cell surface	IDA	21868574
GO:0010628	Process	Positive regulation of gene expression	IMP	21868574, 28341552
GO:0016020	Component	Membrane	IDA	27018888
GO:0016021	Component	Integral component of membrane	IEA
GO:0016787	Function	Hydrolase activity	IMP	27018888
GO:0030195	Process	Negative regulation of blood coagulation	IMP	21868574
GO:0042758	Process	Long-chain fatty acid catabolic process	IMP	27018888
GO:0043491	Process	Protein kinase B signaling	IMP	28341552
GO:0050709	Process	Negative regulation of protein secretion	IMP	28341552
GO:0071383	Process	Cellular response to steroid hormone stimulus	IEP	21868574
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IMP	28341552
GO:1903038	Process	Negative regulation of leukocyte cell-cell adhesion	IMP	28341552
GO:2000402	Process	Negative regulation of lymphocyte migration	IMP	28341552

Other IDs

• MIM: 614348
• HGNC: 21214
• e!Ensembl: ENSG00000111863

Protein

• UniProt ID: Q96IZ2
• Protein name: Androgen-dependent TFPI-regulating protein (Fatty acid esters of hydroxy fatty acids hydrolase ADTRP) (FAHFA hydrolase ADTRP) (EC 3.1.-.-)
• Protein function: Hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), but not other major classes of lipids (PubMed:27018888). Show a preference for FAHFAs with branching distal from the carboxylate head group of the lipids (PubMed:27018888).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04750	Far-17a_AIG1	5 → 216	FAR-17a/AIG1-like protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in cultured endothelial cells and in placenta. {ECO:0000269|PubMed:21868574}.
• Sequence:

  MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGV
  TCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDT
  VIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTW
  VYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK

• Sequence length: 230

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537	21378986

Unknown
Disease term	Disease name	Evidence	References	Source
Coronary heart disease	Coronary heart disease		21378986	ClinVar
Neuroticism	Neuroticism			GWAS
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.		GWAS, CBGDA

Associations from Text Mining
Disease Name	Relationship Type	References
Asymptomatic Diseases	Associate	25928384
Atherosclerosis	Associate	25595457, 28341552, 28645652
Cardiovascular Diseases	Associate	28645652
Cerebral Arterial Diseases	Associate	27235449
Coronary Artery Disease	Associate	22952750, 24573017, 25595457, 25928384, 26375920, 27235449, 28341552, 28645652, 32790694, 36435092
Disease	Associate	36435092
Hyperuricemia	Associate	25928384
Leiomyoma	Associate	28715450
Obesity	Inhibit	25595457