Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84818
Gene name	Interleukin 17 receptor C
Gene symbol	IL17RC
Synonyms (NCBI Gene)	CANDF9IL17-RLIL17RL
Chromosome	3
Chromosome location	3p25.3\|3p25.3-p24.1
Summary	This gene encodes a single-pass type I membrane protein that shares similarity with the interleukin-17 receptor (IL-17RA). Unlike IL-17RA, which is predominantly expressed in hemopoietic cells, and binds with high affinity to only IL-17A, this protein is

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs559955121	C>T	Likely-pathogenic	Coding sequence variant, stop gained, non coding transcript variant
rs773852926	C>T	Pathogenic	Non coding transcript variant, coding sequence variant, stop gained
rs1057518751	C>T	Pathogenic	Stop gained, non coding transcript variant, coding sequence variant

Show/Hide all (5)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028962	hsa-miR-26b-5p	Microarray	19088304
MIRT052327	hsa-let-7b-5p	CLASH	23622248
MIRT050548	hsa-miR-20a-5p	CLASH	23622248
MIRT036625	hsa-miR-940	CLASH	23622248
MIRT036625	hsa-miR-940	CLASH	23622248

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	24120361, 28827714
GO:0005886	Component	Plasma membrane	IC	20554964
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0009986	Component	Cell surface	IEA
GO:0015026	Function	Coreceptor activity	IDA	20554964
GO:0016020	Component	Membrane	IEA
GO:0030368	Function	Interleukin-17 receptor activity	IBA
GO:0030368	Function	Interleukin-17 receptor activity	IDA	17911633
GO:0030368	Function	Interleukin-17 receptor activity	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0038173	Process	Interleukin-17A-mediated signaling pathway	IDA	19825828, 31376257, 35183823
GO:0038173	Process	Interleukin-17A-mediated signaling pathway	IDA	20554964
GO:0050832	Process	Defense response to fungus	IEA
GO:0071621	Process	Granulocyte chemotaxis	IEA
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IEA

MIM	HGNC	e!Ensembl
610925	18358	ENSG00000163702

Q8NAC3

Protein name

Interleukin-17 receptor C (IL-17 receptor C) (IL-17RC) (Interleukin-17 receptor homolog) (IL17Rhom) (Interleukin-17 receptor-like protein) (IL-17RL) (ZcytoR14)

Protein function

Receptor for IL17A and IL17F, major effector cytokines of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity (By similarity). Receptor for IL17A and IL17F, major effector cytokines of inn

PDB

6HG4 , 6HG9 , 6HGA , 7UWN , 7ZAN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15037	IL17_R_N	142 → 530	Interleukin-17 receptor extracellular region	Family
PF08357	SEFIR	584 → 737	SEFIR domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in prostate, skeletal muscle, kidney and placenta (at protein level) (PubMed:11706037). Expressed in brain, cartilage, colon, heart, intestine, kidney, liver, lung, muscle, placenta, and prostate (PubMed:11706037). Also detec

Sequence

MPVPWFLLSLALGRSPVVLSLERLVGPQDATHCSPVSLEPWGDEERLRVQFLAQQSLSLA
PVTAATARTALSGLSGADGRREERGRGKSWVCLSLGGSGNTEPQKKGLSCRLWDSDILCL
PGDIVPAPGPVLAPTHLQTELVLRCQKETDCDLCLRVAVHLAVHGHWEEPEDEEKFGGAA
DSGVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPAALVQFGQSVGSVVYDCFEAALGS
EVRIWSYTQPRYEKELNHTQQLPDCRGLEVWNSIPSCWALPWLNVSADGDNVHLVLNVSE
EQHFGLSLYWNQVQGPPKPRWHKNLTGPQIITLNHTDLVPCLCIQVWPLEPDSVRTNICP
FREDPRAHQNLWQAARLQLLTLQSWLLDAPCSLPAEAALCWRAPGGDPCQPLVPPLSWEN
VTVDKVLEFPLLKGHPNLCVQVNSSEKLQLQECLWADSLGPLKDDVLLLETRGPQDNRSL
CALEPSGCTSLPSKASTRAARLGEYLLQDLQSGQCLQLWDDDLGALWACPMDKYIHKRWA
LVWLACLLFAAALSLILLLKKDHAKGWLRLLKQDVRSGAAARGRAALLLYSADDSGFERL
VGALASALCQLPLRVAVDLWSRRELSAQGPVAWFHAQRRQTLQEGGVVVLLFSPGAVALC
SEWLQDGVSGPGAHGPHDAFRASLSCVLPDFLQGRAPGSYVGACFDRLLHPDAVPALFRT
VPVFTLPSQLPDFLGALQQPRAPRSGRLQERAEQVSRALQPALDSYFHPPGTPAPGRGVG
PGAGPGAGDGT

Sequence length

791

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction IL-17 signaling pathway Alcoholic liver disease		Interleukin-17 signaling

705

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Candidiasis, familial, 9	Likely pathogenic; Pathogenic	rs755012426, rs1057518751, rs143600903	RCV003227540 RCV000412591 RCV000412524

Show/Hide Unknown Diseases (16)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Adrenocortical carcinoma, hereditary	Benign; Likely benign	rs148575246	RCV005900362
Cervical cancer	Benign; Likely benign	rs148575246	RCV005900363
Colon adenocarcinoma	Benign	rs75692599	RCV005897191
Familial cancer of breast	Benign	rs9864177	RCV005900371
Hepatocellular carcinoma	Benign; Likely benign	rs148575246	RCV005900360
IL17RC-related disorder	Likely benign; Benign; Conflicting classifications of pathogenicity	rs1229606921, rs75324888, rs138985119, rs148575246, rs7643547, rs143412184, rs11719981, rs200220568, rs115095463, rs201879409, rs75116348, rs192927730, rs142241185	RCV003944441 RCV003980034 RCV003915643 RCV003918085 RCV003918084 RCV003965408 RCV003928136 RCV003937991 RCV003413768 RCV003957967 RCV003975546 RCV003923207 RCV003970400
Lung cancer	Benign; Likely benign	rs148575246	RCV005900369
Malignant tumor of esophagus	Benign	rs9864177	RCV005900372
Melanoma	Uncertain significance; Benign; Likely benign	rs775241631, rs148575246	RCV005923926 RCV005900368
Nonpapillary renal cell carcinoma	Benign; Likely benign	rs148575246	RCV005900361
Ovarian serous cystadenocarcinoma	Uncertain significance; Benign; Likely benign	rs769892513, rs768297364, rs148575246, rs115095463	RCV005925652 RCV005934974 RCV005900366 RCV005910597
Sarcoma	Benign; Likely benign	rs9864177, rs148575246	RCV005900373 RCV005900365
Thymoma	Conflicting classifications of pathogenicity	rs371746550	RCV005929202
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	rs148575246	RCV005900367
Uterine corpus endometrial carcinoma	Benign; Likely benign	rs148575246, rs115095463	RCV005900370 RCV005910598
Uveal melanoma	Benign; Likely benign	rs75692599, rs148575246	RCV005897192 RCV005900364

Show/Hide Text Mining Associations (22)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	33802737
Arthritis Rheumatoid	Associate	29584788, 37926850
Cerebral Infarction	Associate	31481525
Colorectal Neoplasms	Associate	26304506, 29548809
Crohn Disease	Associate	38045694
Death	Associate	31481525
Inflammatory Bowel Diseases	Associate	38045694
Macular Degeneration	Associate	23177625, 24780906
Malaria	Associate	23614351
Neoplasms	Associate	37808403
Ossification of Posterior Longitudinal Ligament	Associate	29764467, 31291973
Ossification of the posterior longitudinal ligament of the spine	Associate	31291973
Osteoarthritis	Associate	34054865
Osteoporosis	Associate	23731710
Pemphigoid Bullous	Stimulate	31572359
Prostatic Neoplasms	Associate	17603628, 32537467
Pulmonary Disease Chronic Obstructive	Stimulate	28298222
Sarcoidosis	Stimulate	24885153
Spondylitis Ankylosing	Associate	34744511
Status Asthmaticus	Stimulate	25494178
Thromboangiitis Obliterans	Associate	26829209
Urinary Bladder Neoplasms	Stimulate	27716046

IL17RC (interleukin 17 receptor C)