PLPP7 (phospholipid phosphatase 7 (inactive))

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84814
Gene name Gene Name - the full gene name approved by the HGNC.
Phospholipid phosphatase 7 (inactive)
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PLPP7
Synonyms (NCBI Gene) Gene synonyms aliases
C9orf67, NET39, PPAPDC3
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q34.13
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0005635 Component Nuclear envelope IBA 21873635
GO:0005789 Component Endoplasmic reticulum membrane IEA
GO:0010832 Process Negative regulation of myotube differentiation IEA
GO:0016020 Component Membrane IBA 21873635
GO:0016021 Component Integral component of membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
618743 28174 ENSG00000160539
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8NBV4
Protein name Inactive phospholipid phosphatase 7 (Phosphatidic acid phosphatase type 2 domain-containing protein 3)
Protein function Plays a role as negative regulator of myoblast differentiation, in part through effects on MTOR signaling. Has no detectable enzymatic activity (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01569 PAP2 144 → 261 PAP2 superfamily Family
Sequence 
MPASQSRARARDRNNVLNRAEFLSLNQPPKGGPEPRSSGRKASGPSAQPPPAGDGARERR
QSQQLPEEDCMQLNPSFKGIAFNSLLAIDICMSKRLGVCAGRAASWASARSMVKLIGITG
HGIPWIGGTILCLVKSSTLAGQEVLMNLLLALLLDIMTVAGVQKLIKRRGPYETSPSLLD
YLTMDIYAFPAGHASRAAMVSKFFLSHLVLAVPLRVLLVLWALCVGLSRVMIGRHHVTDV
LSGFVIGYLQFRLVELVWMPSSTCQMLISAW
Sequence length 271
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (3)
Unknown
Disease term Disease name Evidence References Source
Gout Gout GWAS
Glioblastoma Glioblastoma CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587 GWAS, CBGDA
Alzheimer disease Alzheimer disease GWAS