Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	84790
Gene name	Tubulin alpha 1c
Gene symbol	TUBA1C
Synonyms (NCBI Gene)	OZEMA24TUBA6bcm948
Chromosome	12
Chromosome location	12q13.12

Show/Hide all (42)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031663	hsa-miR-16-5p	Proteomics	18668040
MIRT052239	hsa-let-7b-5p	CLASH	23622248
MIRT049110	hsa-miR-92a-3p	CLASH	23622248
MIRT046865	hsa-miR-221-3p	CLASH	23622248
MIRT043045	hsa-miR-324-5p	CLASH	23622248
MIRT038397	hsa-miR-296-3p	CLASH	23622248
MIRT036933	hsa-miR-877-3p	CLASH	23622248
MIRT036769	hsa-miR-760	CLASH	23622248
MIRT036595	hsa-miR-940	CLASH	23622248
MIRT1462997	hsa-miR-122	CLIP-seq
MIRT1462998	hsa-miR-3120-3p	CLIP-seq
MIRT1462999	hsa-miR-3617	CLIP-seq
MIRT1463000	hsa-miR-3688-3p	CLIP-seq
MIRT1463001	hsa-miR-4261	CLIP-seq
MIRT1463002	hsa-miR-4477a	CLIP-seq
MIRT1463003	hsa-miR-4694-3p	CLIP-seq
MIRT1463004	hsa-miR-548al	CLIP-seq
MIRT1463005	hsa-miR-548k	CLIP-seq
MIRT1463006	hsa-miR-548n	CLIP-seq
MIRT1463007	hsa-miR-548t	CLIP-seq
MIRT1463008	hsa-miR-590-3p	CLIP-seq
MIRT1463009	hsa-miR-641	CLIP-seq
MIRT1462997	hsa-miR-122	CLIP-seq
MIRT1462999	hsa-miR-3617	CLIP-seq
MIRT1463004	hsa-miR-548al	CLIP-seq
MIRT1463009	hsa-miR-641	CLIP-seq
MIRT1462997	hsa-miR-122	CLIP-seq
MIRT1462998	hsa-miR-3120-3p	CLIP-seq
MIRT1462999	hsa-miR-3617	CLIP-seq
MIRT1463004	hsa-miR-548al	CLIP-seq
MIRT1463005	hsa-miR-548k	CLIP-seq
MIRT1463006	hsa-miR-548n	CLIP-seq
MIRT1463007	hsa-miR-548t	CLIP-seq
MIRT1463009	hsa-miR-641	CLIP-seq
MIRT1462997	hsa-miR-122	CLIP-seq
MIRT1462998	hsa-miR-3120-3p	CLIP-seq
MIRT1462999	hsa-miR-3617	CLIP-seq
MIRT1463004	hsa-miR-548al	CLIP-seq
MIRT1463005	hsa-miR-548k	CLIP-seq
MIRT1463006	hsa-miR-548n	CLIP-seq
MIRT1463007	hsa-miR-548t	CLIP-seq
MIRT1463009	hsa-miR-641	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0000278	Process	Mitotic cell cycle	IBA
GO:0005198	Function	Structural molecule activity	TAS	12090300
GO:0005200	Function	Structural constituent of cytoskeleton	IBA
GO:0005200	Function	Structural constituent of cytoskeleton	IEA
GO:0005515	Function	Protein binding	IPI	22720776, 25556234, 27107012, 27607350, 32814053
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	22720776
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0005874	Component	Microtubule	TAS	12090300
GO:0005881	Component	Cytoplasmic microtubule	IEA
GO:0005929	Component	Cilium	IDA
GO:0007017	Process	Microtubule-based process	IEA
GO:0007017	Process	Microtubule-based process	TAS	12090300
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0015630	Component	Microtubule cytoskeleton	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030705	Process	Cytoskeleton-dependent intracellular transport	TAS	12090300
GO:0031982	Component	Vesicle	HDA	19190083
GO:0046872	Function	Metal ion binding	IEA
GO:0051301	Process	Cell division	TAS	12090300

MIM	HGNC	e!Ensembl
621161	20768	ENSG00000167553

Q9BQE3

Protein name

Tubulin alpha-1C chain (EC 3.6.5.-) (Alpha-tubulin 6) (Tubulin alpha-6 chain) [Cleaved into: Detyrosinated tubulin alpha-1C chain]

Protein function

Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers. Microtubules grow by the addition of GTP-tubulin dimers to the microtubule en

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00091	Tubulin	3 → 214	Tubulin/FtsZ family, GTPase domain	Domain
PF03953	Tubulin_C	263 → 393	Tubulin C-terminal domain	Domain

Sequence

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGADSADGEDEGEEY

Sequence length

449

Interactions

View interactions

	KEGG		Reactome
	Phagosome Apoptosis Tight junction Gap junction Motor proteins Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Pathogenic Escherichia coli infection Salmonella infection		Microtubule-dependent trafficking of connexons from Golgi to the plasma membrane MHC class II antigen presentation Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion HSP90 chaperone cycle for steroid hormone receptors (SHR) Recruitment of NuMA to mitotic centrosomes Recycling pathway of L1 Hedgehog 'off' state Cilium Assembly Intraflagellar transport RHO GTPases activate IQGAPs RHO GTPases Activate Formins COPI-mediated anterograde transport COPI-dependent Golgi-to-ER retrograde traffic COPI-independent Golgi-to-ER retrograde traffic Mitotic Prometaphase The role of GTSE1 in G2/M progression after G2 checkpoint Carboxyterminal post-translational modifications of tubulin HCMV Early Events Aggrephagy EML4 and NUDC in mitotic spindle formation Sealing of the nuclear envelope (NE) by ESCRT-III Kinesins

TUBA1C (tubulin alpha 1c)