SPSB2 (splA/ryanodine receptor domain and SOCS box containing 2)

Gene

• Entrez ID: 84727
• Gene name: SplA/ryanodine receptor domain and SOCS box containing 2
• Gene symbol: SPSB2
• Synonyms (NCBI Gene): GRCC9, SSB2
• Chromosome: 12
• Chromosome location: 12p13.31
• Summary: This gene encodes a member of a subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal suppressor of cytokine signaling (SOCS) box. This protein plays a role in cell signaling. This gene is present in a gene-rich

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1386580	hsa-miR-1207-3p	CLIP-seq
MIRT1386581	hsa-miR-1226	CLIP-seq
MIRT1386582	hsa-miR-214	CLIP-seq
MIRT1386583	hsa-miR-3619-5p	CLIP-seq
MIRT1386584	hsa-miR-3663-5p	CLIP-seq
MIRT1386585	hsa-miR-4291	CLIP-seq
MIRT1386586	hsa-miR-4733-3p	CLIP-seq
MIRT1386587	hsa-miR-601	CLIP-seq
MIRT1386588	hsa-miR-646	CLIP-seq
MIRT1386589	hsa-miR-761	CLIP-seq
MIRT1386590	hsa-miR-922	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15601820, 19159283, 20561531, 21199876, 23455924, 25814554, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	21199876
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	21199876
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0016567	Process	Protein ubiquitination	IDA	21199876
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019005	Component	SCF ubiquitin ligase complex	IBA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IEA
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IPI	21199876

Other IDs

• MIM: 611658
• HGNC: 29522
• e!Ensembl: ENSG00000111671

Protein

• UniProt ID: Q99619
• Protein name: SPRY domain-containing SOCS box protein 2 (SSB-2) (Gene-rich cluster protein C9)
• Protein function: Substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:15601820, PubMed:21199
• PDB: 3EMW, 5XN3, 6DN5, 6DN6, 6JKJ, 6JWM, 6JWN, 6KEY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00622	SPRY	88 → 218	SPRY domain	Family
  PF07525	SOCS_box	224 → 262	SOCS box	Domain

• Sequence:

  MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVK
  EGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHY
  AALLGSNSESWGWDIGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGY
  AIGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGERRAEPHSLLHLSRLCVRHNLG
  DTRLGQVSALPLPPAMKRYLLYQ

• Sequence length: 263

Pathways

Reactome:

Neddylation
Antigen processing: Ubiquitination & Proteasome degradation

<

Associated diseases

Unknown
Disease merge term	Disease name	Evidence	References	Source
Colorectal Cancer	Colorectal cancer	N/A	N/A	GWAS
Hyperopia	Hyperopia	N/A	N/A	GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Airway Obstruction	Associate	34782693
Borderline Personality Disorder	Associate	25612291
Carcinogenesis	Associate	40149497
Carcinoma Hepatocellular	Associate	40149497
Carcinoma Non Small Cell Lung	Associate	40149497
Colorectal Neoplasms	Associate	26965516
Hepatitis C	Stimulate	31344133
Inflammation	Associate	40149497
Neoplasm Metastasis	Associate	40149497
Pediatric Obesity	Associate	25612291