Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	84722
Gene name	Proline and serine rich coiled-coil 1
Gene symbol	PSRC1
Synonyms (NCBI Gene)	DDA3FP3214
Chromosome	1
Chromosome location	1p13.3
Summary	This gene encodes a proline-rich protein that is a target for regulation by the tumor suppressor protein p53. The encoded protein plays an important role in mitosis by recruiting and regulating microtubule depolymerases that destabalize microtubules. Alte

108

Show/Hide all (108)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016342	hsa-miR-193b-3p	Microarray	20304954
MIRT024463	hsa-miR-215-5p	Microarray	19074876
MIRT026297	hsa-miR-192-5p	Microarray	19074876
MIRT044740	hsa-miR-320a	CLASH	23622248
MIRT1271160	hsa-miR-1182	CLIP-seq
MIRT1271161	hsa-miR-1207-5p	CLIP-seq
MIRT1271162	hsa-miR-1264	CLIP-seq
MIRT1271163	hsa-miR-1287	CLIP-seq
MIRT1271164	hsa-miR-1289	CLIP-seq
MIRT1271165	hsa-miR-1321	CLIP-seq
MIRT1271166	hsa-miR-1972	CLIP-seq
MIRT1271167	hsa-miR-27a	CLIP-seq
MIRT1271168	hsa-miR-27b	CLIP-seq
MIRT1271169	hsa-miR-3123	CLIP-seq
MIRT1271170	hsa-miR-3135b	CLIP-seq
MIRT1271171	hsa-miR-3198	CLIP-seq
MIRT1271172	hsa-miR-3616-3p	CLIP-seq
MIRT1271173	hsa-miR-3925-3p	CLIP-seq
MIRT1271174	hsa-miR-3925-5p	CLIP-seq
MIRT1271175	hsa-miR-4257	CLIP-seq
MIRT1271176	hsa-miR-4261	CLIP-seq
MIRT1271177	hsa-miR-4266	CLIP-seq
MIRT1271178	hsa-miR-4267	CLIP-seq
MIRT1271179	hsa-miR-4268	CLIP-seq
MIRT1271180	hsa-miR-4270	CLIP-seq
MIRT1271181	hsa-miR-4294	CLIP-seq
MIRT1271182	hsa-miR-4309	CLIP-seq
MIRT1271183	hsa-miR-4426	CLIP-seq
MIRT1271184	hsa-miR-4436b-3p	CLIP-seq
MIRT1271185	hsa-miR-4441	CLIP-seq
MIRT1271186	hsa-miR-4496	CLIP-seq
MIRT1271187	hsa-miR-4527	CLIP-seq
MIRT1271188	hsa-miR-4647	CLIP-seq
MIRT1271189	hsa-miR-4662b	CLIP-seq
MIRT1271190	hsa-miR-4686	CLIP-seq
MIRT1271191	hsa-miR-4690-5p	CLIP-seq
MIRT1271192	hsa-miR-4712-5p	CLIP-seq
MIRT1271193	hsa-miR-4739	CLIP-seq
MIRT1271194	hsa-miR-4756-5p	CLIP-seq
MIRT1271195	hsa-miR-4762-3p	CLIP-seq
MIRT1271196	hsa-miR-4763-3p	CLIP-seq
MIRT1271197	hsa-miR-513a-5p	CLIP-seq
MIRT1271198	hsa-miR-515-5p	CLIP-seq
MIRT1271199	hsa-miR-766	CLIP-seq
MIRT1271200	hsa-miR-770-5p	CLIP-seq
MIRT1271201	hsa-miR-873	CLIP-seq
MIRT1271202	hsa-miR-936	CLIP-seq
MIRT1271203	hsa-miR-942	CLIP-seq
MIRT2079749	hsa-miR-181a	CLIP-seq
MIRT2079750	hsa-miR-181b	CLIP-seq
MIRT2079751	hsa-miR-181c	CLIP-seq
MIRT2079752	hsa-miR-181d	CLIP-seq
MIRT2079753	hsa-miR-3163	CLIP-seq
MIRT2079754	hsa-miR-326	CLIP-seq
MIRT2079755	hsa-miR-330-5p	CLIP-seq
MIRT2079756	hsa-miR-3682-5p	CLIP-seq
MIRT2079757	hsa-miR-4262	CLIP-seq
MIRT2079758	hsa-miR-4283	CLIP-seq
MIRT2079759	hsa-miR-4489	CLIP-seq
MIRT2079760	hsa-miR-4656	CLIP-seq
MIRT2079761	hsa-miR-4667-5p	CLIP-seq
MIRT2079762	hsa-miR-4700-5p	CLIP-seq
MIRT2079763	hsa-miR-4709-5p	CLIP-seq
MIRT2079764	hsa-miR-4715-3p	CLIP-seq
MIRT2079765	hsa-miR-486-5p	CLIP-seq
MIRT2079766	hsa-miR-637	CLIP-seq
MIRT1271161	hsa-miR-1207-5p	CLIP-seq
MIRT1271172	hsa-miR-3616-3p	CLIP-seq
MIRT2306078	hsa-miR-370	CLIP-seq
MIRT1271175	hsa-miR-4257	CLIP-seq
MIRT1271179	hsa-miR-4268	CLIP-seq
MIRT1271180	hsa-miR-4270	CLIP-seq
MIRT1271183	hsa-miR-4426	CLIP-seq
MIRT1271184	hsa-miR-4436b-3p	CLIP-seq
MIRT1271185	hsa-miR-4441	CLIP-seq
MIRT1271188	hsa-miR-4647	CLIP-seq
MIRT1271189	hsa-miR-4662b	CLIP-seq
MIRT2079764	hsa-miR-4715-3p	CLIP-seq
MIRT1271196	hsa-miR-4763-3p	CLIP-seq
MIRT2306079	hsa-miR-4763-5p	CLIP-seq
MIRT1271198	hsa-miR-515-5p	CLIP-seq
MIRT2306080	hsa-miR-550a	CLIP-seq
MIRT2306081	hsa-miR-764	CLIP-seq
MIRT2393157	hsa-miR-1261	CLIP-seq
MIRT2393158	hsa-miR-3165	CLIP-seq
MIRT2393159	hsa-miR-4447	CLIP-seq
MIRT2393160	hsa-miR-4472	CLIP-seq
MIRT2393161	hsa-miR-4651	CLIP-seq
MIRT2079763	hsa-miR-4709-5p	CLIP-seq
MIRT2393162	hsa-miR-608	CLIP-seq
MIRT1271160	hsa-miR-1182	CLIP-seq
MIRT2457368	hsa-miR-3132	CLIP-seq
MIRT2457369	hsa-miR-4451	CLIP-seq
MIRT1271187	hsa-miR-4527	CLIP-seq
MIRT2457370	hsa-miR-4731-5p	CLIP-seq
MIRT1271166	hsa-miR-1972	CLIP-seq
MIRT1271169	hsa-miR-3123	CLIP-seq
MIRT1271174	hsa-miR-3925-5p	CLIP-seq
MIRT1271183	hsa-miR-4426	CLIP-seq
MIRT1271188	hsa-miR-4647	CLIP-seq
MIRT1271189	hsa-miR-4662b	CLIP-seq
MIRT1271191	hsa-miR-4690-5p	CLIP-seq
MIRT1271192	hsa-miR-4712-5p	CLIP-seq
MIRT2079764	hsa-miR-4715-3p	CLIP-seq
MIRT1271198	hsa-miR-515-5p	CLIP-seq
MIRT1271200	hsa-miR-770-5p	CLIP-seq
MIRT1271201	hsa-miR-873	CLIP-seq
MIRT1271202	hsa-miR-936	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IBA
GO:0000922	Component	Spindle pole	IDA	18411309
GO:0000922	Component	Spindle pole	IEA
GO:0001578	Process	Microtubule bundle formation	IEA
GO:0001578	Process	Microtubule bundle formation	ISS	12427559
GO:0005515	Function	Protein binding	IPI	18411309, 26820536, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS	12427559
GO:0005819	Component	Spindle	IEA
GO:0005819	Component	Spindle	ISS	12427559
GO:0005829	Component	Cytosol	IDA	18411309
GO:0005856	Component	Cytoskeleton	IEA
GO:0005876	Component	Spindle microtubule	IBA
GO:0005876	Component	Spindle microtubule	IDA	18411309
GO:0007080	Process	Mitotic metaphase chromosome alignment	IBA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IDA	18411309
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0008017	Function	Microtubule binding	ISS	12427559
GO:0015630	Component	Microtubule cytoskeleton	IBA
GO:0015630	Component	Microtubule cytoskeleton	IEA
GO:0015630	Component	Microtubule cytoskeleton	ISS	12427559
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0030308	Process	Negative regulation of cell growth	ISS	12427559
GO:0030496	Component	Midbody	IEA
GO:0030496	Component	Midbody	ISS	12427559
GO:0031116	Process	Positive regulation of microtubule polymerization	IEA
GO:0031116	Process	Positive regulation of microtubule polymerization	ISS	12427559
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS	12427559
GO:0051301	Process	Cell division	IEA
GO:0060236	Process	Regulation of mitotic spindle organization	IDA	18411309

MIM	HGNC	e!Ensembl
613126	24472	ENSG00000134222

Q6PGN9

Protein name

Proline/serine-rich coiled-coil protein 1

Protein function

Required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate, and for normal rate of chromosomal segregation during anaphase. Plays a role in the regulation of mitotic spindle dynamics. Incr

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15259	GTSE1_N	8 → 118	G-2 and S-phase expressed 1	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed in adult and fetal tissues, with highest expression in the adult brain and fetal thymus. Not detected in adult skeletal muscle. {ECO:0000269|PubMed:12427559}.

Sequence

MEDLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQ
GVRLSLGPLSPEKLEEILDEANRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLK
DSPVRDLLPTVNSLTRSTPSPSSLTPRLRSNDRKGSVRALRATSGKRPSNMKRESPTCNL
FPASKSPASSPLTRSTPPVRGRAGPSGRAAASEETRAAKLRVSGSGEFVGLTLKFLHPSP
PGPPTPIRSVLAPQPSTSNSQRLPRPQGAAAKSSSQLPIPSAIPRPASRMPLTSRSVPPG
RGALPPDSLSTRKGLPRPSTAGHRVRESGHKVPVSQRLNLPVMGATRSNLQPPRKVAVPG
PTR

Sequence length

363

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANEURYSM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ANEURYSM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARGE ARTERY STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL VASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Acute Coronary Syndrome	Associate	25969834	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Associate	23535823, 37893562	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	22380622	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Associate	25969834	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Associate	32238911	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	26070530	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Associate	24725463	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	22065898	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	18979498, 24725463	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Associate	19951432	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Associate	26464717	★★★★★ ★☆☆☆☆ Found in Text Mining only
Constriction Pathologic	Associate	25969834	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Associate	17634449, 19164808, 22380622, 23535823, 24674750, 25528061, 26464717, 32858814, 34447459	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Inhibit	34447459	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease Autosomal Dominant 1	Associate	22216278	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Associate	18979498, 19955471, 22152955	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Associate	37582372	★★★★★ ★☆☆☆☆ Found in Text Mining only
Facioscapulohumeral muscular dystrophy 1a	Associate	22380622	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	39261532	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Associate	20839009, 21463265	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myotonic Dystrophy	Associate	29356453	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	24709098	★★★★★ ★☆☆☆☆ Found in Text Mining only
Overweight	Associate	24709098	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	26214778	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Associate	29356453	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Associate	22380622	★★★★★ ★☆☆☆☆ Found in Text Mining only

PSRC1 (proline and serine rich coiled-coil 1)