LNX1 (ligand of numb-protein X 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84708
Gene name Gene Name - the full gene name approved by the HGNC.
Ligand of numb-protein X 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LNX1
Synonyms (NCBI Gene) Gene synonyms aliases
LNX, MPDZ, PDZRN2
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a membrane-bound protein that is involved in signal transduction and protein interactions. The encoded product is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(8)
miRTarBase ID miRNA Experiments Reference
MIRT1112452 hsa-miR-495 CLIP-seq
MIRT1112453 hsa-miR-513a-3p CLIP-seq
MIRT1112454 hsa-miR-549 CLIP-seq
MIRT1112455 hsa-miR-590-3p CLIP-seq
MIRT1112456 hsa-miR-664 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(8)
GO ID Ontology Definition Evidence Reference
GO:0004842 Function Ubiquitin-protein transferase activity IEA
GO:0005515 Function Protein binding IPI 16002321, 16189514, 16713569, 17936276, 20864041, 21516116, 25416956, 25910212, 27107012, 29892012, 31515488, 32296183, 32814053
GO:0005737 Component Cytoplasm IEA
GO:0006511 Process Ubiquitin-dependent protein catabolic process IEA
GO:0016567 Process Protein ubiquitination IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
609732 6657 ENSG00000072201
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q8TBB1
Protein name E3 ubiquitin-protein ligase LNX (EC 2.3.2.27) (Ligand of Numb-protein X 1) (Numb-binding protein 1) (PDZ domain-containing RING finger protein 2) (RING-type E3 ubiquitin transferase LNX)
Protein function E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of NUMB. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubi
PDB 3B76 , 5H7R , 5H7S
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13920 zf-C3HC4_3 37 → 84 Domain
PF00595 PDZ 274 → 356 PDZ domain Domain
PF00595 PDZ 381 → 461 PDZ domain Domain
PF00595 PDZ 507 → 590 PDZ domain Domain
PF00595 PDZ 638 → 721 PDZ domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, placenta, kidney, pancreas and brain. {ECO:0000269|PubMed:11521506}.
Sequence 
MNQPESANDPEPLCAVCGQAHSLEENHFYSYPEEVDDDLICHICLQALLDPLDTPCGHTY
CTLCLTNFLVEKDFCPMDRKPLVLQHCKKSSILVNKLLNKLLVTCPFREHCTQVLQRCDL
EHHFQTSCKGASHYGLTKDRKRRSQDGCPDGCASLTATAPSPEVSAAATISLMTDEPGLD
NPAYVSSAEDGQPAISPVDSGRSNRTRARPFERSTIRSRSFKKINRALSVLRRTKSGSAV
ANHADQGRENSENTTAPEVFPRLYHLIPDGEITSIKINRVDPSESLSIRLVGGSETPLVH
IIIQHIYRDGVIARDGRLLPGDIILKVNGMDISNVPHNYAVRLLRQPCQVLWLTVMREQK
FRSRNNGQAPDAYRPRDDSFHVILNKSSPEEQLGIKLVRKVDEPGVFIFNVLDGGVAYRH
GQLEENDRVLAINGHDLRYGSPESAAHLIQASERRVHLVVSRQVRQRSPDIFQEAGWNSN
GSWSPGPGERSNTPKPLHPTITCHEKVVNIQKDPGESLGMTVAGGASHREWDLPIYVISV
EPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVALLKRTSSSIVLKALEVKEYEPQED
CSSPAALDSNHNMAPPSDWSPSWVMWLELPRCLYNCKDIVLRRNTAGSLGFCIVGGYEEY
NGNKPFFIKSIVEGTPAYNDGRIRCGDILLAVNGRSTSGMIHACLARLLKELKGRITLTI
VSWPGTFL
Sequence length 728
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Show/Hide Unknown Diseases (5)
Unknown
Disease term Disease name Evidence References Source
Asthma Asthma GWAS
Uterine Fibroids Uterine Fibroids GWAS
Coronary artery disease Coronary artery disease GWAS
Oligodendroglioma Oligodendroglioma GWAS
Show/Hide Text Mining Associations (10)
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Stimulate 29190716
Colorectal Neoplasms Associate 29190716
Diabetes Mellitus Type 1 Associate 35650387
Endocarditis Associate 22066909
Hypoalphalipoproteinemias Associate 32541515
Inflammation Associate 19132087
Mucocutaneous Lymph Node Syndrome Associate 19132087
Nasopharyngeal Carcinoma Associate 32541515
Neoplasms Inhibit 29190716
Q Fever Associate 22066909