GJA10 (gap junction protein alpha 10)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein Pathways
Entrez ID 84694
Gene name Gap junction protein alpha 10
Gene symbol GJA10
Synonyms (NCBI Gene)
CX62
Chromosome 6
Chromosome location 6q15
Summary Connexins, such as GJA10, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
Gene Gene ontology Other IDs Protein Pathways
Show/Hide all (16)
GO ID Ontology Definition Evidence Reference
GO:0005243 Function Gap junction channel activity IBA
GO:0005243 Function Gap junction channel activity IEA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0005921 Component Gap junction IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
611924 16995 ENSG00000135355
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q969M2
Protein name Gap junction alpha-10 protein (Connexin-62) (Cx62)
Protein function One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Involved in tracer coupling between horizontal cells of the r
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00029 Connexin 3 → 235 Connexin Family
Tissue specificity TISSUE SPECIFICITY: Expressed in skeletal muscle and heart. {ECO:0000269|PubMed:12881038}.
Sequence 
MGDWNLLGGILEEVHSHSTIVGKIWLTILFIFRMLVLRVAAEDVWDDEQSAFACNTRQPG
CNNICYDDAFPISLIRFWVLQIIFVSSPSLVYMGHALYRLRAFEKDRQRKKSHLRAQMEN
PDLDLEEQQRIDRELRRLEEQKRIHKVPLKGCLLRTYVLHILTRSVLEVGFMIGQYILYG
FQMHPLYKCTQPPCPNAVDCFVSRPTEKTIFMLFMHSIAAISLLLNILEIFHLGIRKIMR
TLYKKSSSEGIEDETGPPFHLKKYSVAQQCMICSSLPERISPLQANNQQQVIRVNVPKSK
TMWQIPQPRQLEVDPSNGKKDWSEKDQHSGQLHVHSPCPWAGSAGNQHLGQQSDHSSFGL
QNTMSQSWLGTTTAPRNCPSFAVGTWEQSQDPEPSGEPLTDLHSHCRDSEGSMRESGVWI
DRSRPGSRKASFLSRLLSEKRHLHSDSGSSGSRNSSCLDFPHWENSPSPLPSVTGHRTSM
VRQAALPIMELSQELFHSGCFLFPFFLPGVCMYVCVDREADGGGDYLWRDKIIHSIHSVK
FNS
Sequence length 543
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways
  Reactome
    Electric Transmission Across Gap Junctions
Gap junction assembly