Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84662
Gene name Gene Name - the full gene name approved by the HGNC.
GLIS family zinc finger 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GLIS2
Synonyms (NCBI Gene) Gene synonyms aliases
NKL, NPHP7
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the GLI-similar zinc finger protein family and encodes a nuclear transcription factor with five C2H2-type zinc finger domains. The protein encoded by this gene is widely expressed at low levels in the neural tube and peripheral ne
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs144447862 A>T Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs150071733 C>A,T Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, missense variant, synonymous variant
rs587777353 T>C Pathogenic Missense variant, coding sequence variant
rs753999588 C>T Conflicting-interpretations-of-pathogenicity Synonymous variant, coding sequence variant
rs878855335 G>T Pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT050468 hsa-miR-22-3p CLASH 23622248
MIRT755863 hsa-miR-3142 Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP), Immunohistochemistry (IHC), RNA pull down assay 36574090
MIRT1021082 hsa-miR-1 CLIP-seq
MIRT1021083 hsa-miR-1205 CLIP-seq
MIRT1021084 hsa-miR-1275 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000976 Function Transcription cis-regulatory region binding ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608539 29450 ENSG00000126603
Protein
UniProt ID Q9BZE0
Protein name Zinc finger protein GLIS2 (GLI-similar 2) (Neuronal Krueppel-like protein)
Protein function Can act either as a transcriptional repressor or as a transcriptional activator, depending on the cell context. Acts as a repressor of the Hedgehog signaling pathway (By similarity). Represses the Hedgehog-dependent expression of Wnt4 (By simila
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 235 257 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 263 287 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 293 317 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed at high levels in kidney and at low levels in heart, lung and placenta. Expressed in colon. {ECO:0000269|PubMed:11738817, ECO:0000269|PubMed:17289029}.
Sequence
MHSLDEPLDLKLSITKLRAAREKRERTLGVVRPRALHRELGLVDDSPTPGSPGSPPSGFL
LNSKFPEKVEGRFSAAPLVDLSLSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPL
RYLDGVPSSFQFFLPLGSGGALHLPASSFLTPPKDKCLSPDLPLPKQLVCRWAKCNQLFE
LLQDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNEKPHRCPTC
SKSFSRLENLKIHNRSH
TGEKPYVCPYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMPGC
HKRYTDPSSLRKHIKAH
GHFVSHEQQELLQLRPPPKPPLPAPDGGPYVSGAQIIIPNPAA
LFGGPGLPGLPLPLAPGPLDLSALACGNGGGSGGGGGMGPGLPGPVLPLNLAKNPLLPSP
FGAGGLGLPVVSLLAGAAGGKAEGEKGRGSVPTRALGMEGHKTPLERTESSCSRPSPDGL
PLLPGTVLDLSTGVNSAASSPEALAPGWVVIPPGSVLLKPAVVN
Sequence length 524
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Nephronophthisis nephronophthisis, nephronophthisis 7 rs878855335 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Inhibit 37574724
Caroli Disease Associate 23559409
Chromosome 7 monosomy Associate 27114462
Ciliopathies Associate 21068128, 23559409
Colorectal Neoplasms Associate 32968054
Fibrosis Associate 34237252
Leukemia Associate 31719049, 34768865
Leukemia Stimulate 36585521
Leukemia Megakaryoblastic Acute Associate 27094503, 27114462, 28109323, 31719049, 35294081
Leukemia Myeloid Acute Associate 23407549, 24127550, 28109323, 31719049, 31825998, 32865882, 33811445, 36585521