Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	84661
Gene name Gene Name - the full gene name approved by the HGNC.	Dpy-30 histone methyltransferase complex regulatory subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DPY30
Synonyms (NCBI Gene) Gene synonyms aliases	Cps25, HDPY-30, Saf19
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p22.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes an integral core subunit of the SET1/MLL family of H3K4 methyltransferases. The encoded protein directly controls cell cycle regulators and plays an important role in the proliferation and differentiation of human hematopoietic progenito

Show/Hide all(59)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023776	hsa-miR-1-3p	Proteomics	18668040
MIRT944887	hsa-miR-101	CLIP-seq
MIRT944888	hsa-miR-1267	CLIP-seq
MIRT944889	hsa-miR-139-5p	CLIP-seq
MIRT944890	hsa-miR-144	CLIP-seq
MIRT944891	hsa-miR-2052	CLIP-seq
MIRT944892	hsa-miR-2116	CLIP-seq
MIRT944893	hsa-miR-2276	CLIP-seq
MIRT944894	hsa-miR-3180-5p	CLIP-seq
MIRT944895	hsa-miR-3182	CLIP-seq
MIRT944896	hsa-miR-3200-5p	CLIP-seq
MIRT944897	hsa-miR-3974	CLIP-seq
MIRT944898	hsa-miR-4251	CLIP-seq
MIRT944899	hsa-miR-4329	CLIP-seq
MIRT944900	hsa-miR-4475	CLIP-seq
MIRT944901	hsa-miR-4495	CLIP-seq
MIRT944902	hsa-miR-4645-3p	CLIP-seq
MIRT944903	hsa-miR-4652-3p	CLIP-seq
MIRT944904	hsa-miR-4677-5p	CLIP-seq
MIRT944905	hsa-miR-4694-5p	CLIP-seq
MIRT944906	hsa-miR-4698	CLIP-seq
MIRT944907	hsa-miR-4772-3p	CLIP-seq
MIRT944908	hsa-miR-4789-5p	CLIP-seq
MIRT944909	hsa-miR-493	CLIP-seq
MIRT944910	hsa-miR-513a-3p	CLIP-seq
MIRT944911	hsa-miR-514	CLIP-seq
MIRT944912	hsa-miR-514b-3p	CLIP-seq
MIRT944913	hsa-miR-520a-5p	CLIP-seq
MIRT944914	hsa-miR-525-5p	CLIP-seq
MIRT944915	hsa-miR-539	CLIP-seq
MIRT944916	hsa-miR-544	CLIP-seq
MIRT944917	hsa-miR-548ac	CLIP-seq
MIRT944918	hsa-miR-548ae	CLIP-seq
MIRT944919	hsa-miR-548aj	CLIP-seq
MIRT944920	hsa-miR-548am	CLIP-seq
MIRT944921	hsa-miR-548d-3p	CLIP-seq
MIRT944922	hsa-miR-548u	CLIP-seq
MIRT944923	hsa-miR-548x	CLIP-seq
MIRT944924	hsa-miR-548z	CLIP-seq
MIRT944887	hsa-miR-101	CLIP-seq
MIRT944889	hsa-miR-139-5p	CLIP-seq
MIRT944890	hsa-miR-144	CLIP-seq
MIRT1979712	hsa-miR-25	CLIP-seq
MIRT1979713	hsa-miR-299-5p	CLIP-seq
MIRT1979714	hsa-miR-3121-3p	CLIP-seq
MIRT1979715	hsa-miR-32	CLIP-seq
MIRT1979716	hsa-miR-331-5p	CLIP-seq
MIRT1979717	hsa-miR-363	CLIP-seq
MIRT1979718	hsa-miR-367	CLIP-seq
MIRT944903	hsa-miR-4652-3p	CLIP-seq
MIRT1979719	hsa-miR-4678	CLIP-seq
MIRT944910	hsa-miR-513a-3p	CLIP-seq
MIRT1979720	hsa-miR-584	CLIP-seq
MIRT1979721	hsa-miR-92a	CLIP-seq
MIRT1979722	hsa-miR-92b	CLIP-seq
MIRT944892	hsa-miR-2116	CLIP-seq
MIRT2214901	hsa-miR-2681	CLIP-seq
MIRT944908	hsa-miR-4789-5p	CLIP-seq
MIRT2214902	hsa-miR-583	CLIP-seq

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 17500065, 19556245, 21516116, 23414517, 23995757, 24722188, 24981860, 25416956, 25456412, 31485071, 31515488, 32296183
GO:0005634	Component	Nucleus	IDA	17500065, 19651892
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005794	Component	Golgi apparatus	IDA
GO:0005802	Component	Trans-Golgi network	IDA	19651892
GO:0006348	Process	Chromatin silencing at telomere	IBA	21873635
GO:0016197	Process	Endosomal transport	IMP	19651892
GO:0035097	Component	Histone methyltransferase complex	IDA	17500065, 19556245
GO:0042802	Function	Identical protein binding	IPI	16189514, 19556245, 25416956, 32296183
GO:0042803	Function	Protein homodimerization activity	IPI	19556245
GO:0044666	Component	MLL3/4 complex	IDA	17500065
GO:0045652	Process	Regulation of megakaryocyte differentiation	TAS
GO:0048188	Component	Set1C/COMPASS complex	IBA	21873635
GO:0048188	Component	Set1C/COMPASS complex	IDA	18838538
GO:0051568	Process	Histone H3-K4 methylation	IBA	21873635
GO:0051568	Process	Histone H3-K4 methylation	IDA	19556245

MIM	HGNC	e!Ensembl
612032	24590	ENSG00000162961

Protein

UniProt ID

Q9C005

Protein name

Protein dpy-30 homolog (Dpy-30-like protein) (Dpy-30L)

Protein function

As part of the MLL1/MLL complex, involved in the methylation of histone H3 at 'Lys-4', particularly trimethylation. Histone H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. May play some role in histone

PDB

3G36 , 4RIQ , 4RT4 , 4RTA , 6E2H , 6PWV , 7UD5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05186	Dpy-30	52 → 93	Dpy-30 motif	Motif

Sequence

MEPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQT
VVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFEDRN

Sequence length

Interactions

View interactions

	Reactome
			PKMTs methylate histone lysines RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587		GWAS, CBGDA

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text Mining
Altitude Sickness	Associate	32299499
Cholangiocarcinoma	Associate	31846841
Colorectal Neoplasms	Stimulate	37324189
Genetic Diseases Inborn	Associate	29481671
Hematologic Neoplasms	Associate	31251903
Leukemia	Associate	31251903
Leukemia Biphenotypic Acute	Associate	28633016
Neoplasms	Associate	30221689, 31251903
Neoplasms	Stimulate	37324189
Spastic Paraplegia Hereditary	Associate	29481671
Spastic Paraplegia Type 4	Associate	24690193
Stomach Neoplasms	Associate	26147337

DPY30 (dpy-30 histone methyltransferase complex regulatory subunit)