Gene Gene information from NCBI Gene database.
Entrez ID 84661
Gene name Dpy-30 histone methyltransferase complex regulatory subunit
Gene symbol DPY30
Synonyms (NCBI Gene)
Cps25HDPY-30Saf19
Chromosome 2
Chromosome location 2p22.3
Summary This gene encodes an integral core subunit of the SET1/MLL family of H3K4 methyltransferases. The encoded protein directly controls cell cycle regulators and plays an important role in the proliferation and differentiation of human hematopoietic progenito
miRNA miRNA information provided by mirtarbase database.
59
miRTarBase ID miRNA Experiments Reference
MIRT023776 hsa-miR-1-3p Proteomics 18668040
MIRT944887 hsa-miR-101 CLIP-seq
MIRT944888 hsa-miR-1267 CLIP-seq
MIRT944889 hsa-miR-139-5p CLIP-seq
MIRT944890 hsa-miR-144 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 17500065, 19556245, 21516116, 23414517, 23995757, 24722188, 24981860, 25416956, 25456412, 31485071, 31515488, 32296183, 33961781
GO:0005634 Component Nucleus IDA 17500065, 19651892
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612032 24590 ENSG00000162961
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9C005
Protein name Protein dpy-30 homolog (Dpy-30-like protein) (Dpy-30L)
Protein function As part of the MLL1/MLL complex, involved in the methylation of histone H3 at 'Lys-4', particularly trimethylation. Histone H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. May play some role in histone
PDB 3G36 , 4RIQ , 4RT4 , 4RTA , 6E2H , 6PWV , 7UD5
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05186 Dpy-30 52 93 Dpy-30 motif Motif
Sequence
MEPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQT
VVPILLQGLAVLAKERPPNPIEFLASYLLKNKA
QFEDRN
Sequence length 99
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    PKMTs methylate histone lysines
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function