Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84649
Gene name	Diacylglycerol O-acyltransferase 2
Gene symbol	DGAT2
Synonyms (NCBI Gene)	ARATGS1999FULLHMFN1045
Chromosome	11
Chromosome location	11q13.5
Summary	This gene encodes one of two enzymes which catalyzes the final reaction in the synthesis of triglycerides in which diacylglycerol is covalently bound to long chain fatty acyl-CoAs. The encoded protein catalyzes this reaction at low concentrations of magne

Show/Hide all (74)

miRTarBase ID	miRNA	Experiments	Reference
MIRT567789	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT567788	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT567787	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT567786	hsa-miR-3609	PAR-CLIP	20371350
MIRT567785	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT567784	hsa-miR-4476	PAR-CLIP	20371350
MIRT567783	hsa-miR-6876-5p	PAR-CLIP	20371350
MIRT567782	hsa-miR-5582-5p	PAR-CLIP	20371350
MIRT567781	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT567780	hsa-miR-3664-3p	PAR-CLIP	20371350
MIRT567779	hsa-miR-605-3p	PAR-CLIP	20371350
MIRT567778	hsa-miR-3975	PAR-CLIP	20371350
MIRT567777	hsa-miR-2467-5p	PAR-CLIP	20371350
MIRT567776	hsa-miR-485-5p	PAR-CLIP	20371350
MIRT567775	hsa-miR-6884-5p	PAR-CLIP	20371350
MIRT567774	hsa-miR-3188	PAR-CLIP	20371350
MIRT567773	hsa-miR-4316	PAR-CLIP	20371350
MIRT497958	hsa-miR-3133	PAR-CLIP	22291592
MIRT497957	hsa-miR-4511	PAR-CLIP	22291592
MIRT497956	hsa-miR-320e	PAR-CLIP	22291592
MIRT497955	hsa-miR-203a-3p	PAR-CLIP	22291592
MIRT440825	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440825	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT567789	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT567788	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT567787	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT567786	hsa-miR-3609	PAR-CLIP	20371350
MIRT567785	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT567784	hsa-miR-4476	PAR-CLIP	20371350
MIRT567783	hsa-miR-6876-5p	PAR-CLIP	20371350
MIRT567782	hsa-miR-5582-5p	PAR-CLIP	20371350
MIRT567781	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT567780	hsa-miR-3664-3p	PAR-CLIP	20371350
MIRT567779	hsa-miR-605-3p	PAR-CLIP	20371350
MIRT567778	hsa-miR-3975	PAR-CLIP	20371350
MIRT567777	hsa-miR-2467-5p	PAR-CLIP	20371350
MIRT567776	hsa-miR-485-5p	PAR-CLIP	20371350
MIRT567775	hsa-miR-6884-5p	PAR-CLIP	20371350
MIRT567774	hsa-miR-3188	PAR-CLIP	20371350
MIRT567773	hsa-miR-4316	PAR-CLIP	20371350
MIRT497958	hsa-miR-3133	PAR-CLIP	22291592
MIRT497957	hsa-miR-4511	PAR-CLIP	22291592
MIRT497956	hsa-miR-320e	PAR-CLIP	22291592
MIRT497955	hsa-miR-203a-3p	PAR-CLIP	22291592
MIRT933603	hsa-miR-1205	CLIP-seq
MIRT933604	hsa-miR-1273d	CLIP-seq
MIRT933605	hsa-miR-1295	CLIP-seq
MIRT933606	hsa-miR-1909	CLIP-seq
MIRT933607	hsa-miR-1912	CLIP-seq
MIRT933608	hsa-miR-3185	CLIP-seq
MIRT933609	hsa-miR-3202	CLIP-seq
MIRT933610	hsa-miR-331-3p	CLIP-seq
MIRT933611	hsa-miR-3679-3p	CLIP-seq
MIRT933612	hsa-miR-4663	CLIP-seq
MIRT933613	hsa-miR-4747-3p	CLIP-seq
MIRT933614	hsa-miR-616	CLIP-seq
MIRT933615	hsa-miR-668	CLIP-seq
MIRT933616	hsa-miR-873	CLIP-seq
MIRT2211795	hsa-miR-1910	CLIP-seq
MIRT2211796	hsa-miR-2110	CLIP-seq
MIRT2211797	hsa-miR-3157-5p	CLIP-seq
MIRT2211798	hsa-miR-324-5p	CLIP-seq
MIRT2211799	hsa-miR-4271	CLIP-seq
MIRT2211800	hsa-miR-4661-3p	CLIP-seq
MIRT2211801	hsa-miR-4667-5p	CLIP-seq
MIRT2211802	hsa-miR-4691-3p	CLIP-seq
MIRT2211803	hsa-miR-4700-5p	CLIP-seq
MIRT2211804	hsa-miR-4716-5p	CLIP-seq
MIRT2211805	hsa-miR-4725-3p	CLIP-seq
MIRT2211806	hsa-miR-4747-5p	CLIP-seq
MIRT2211807	hsa-miR-486-3p	CLIP-seq
MIRT2211808	hsa-miR-548ag	CLIP-seq
MIRT2211809	hsa-miR-548ai	CLIP-seq
MIRT2211810	hsa-miR-637	CLIP-seq

Show/Hide all (71)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003846	Function	2-acylglycerol O-acyltransferase activity	IEA
GO:0004144	Function	Diacylglycerol O-acyltransferase activity	EXP	11481335
GO:0004144	Function	Diacylglycerol O-acyltransferase activity	IBA
GO:0004144	Function	Diacylglycerol O-acyltransferase activity	IDA	11481335, 27184406
GO:0004144	Function	Diacylglycerol O-acyltransferase activity	IEA
GO:0005515	Function	Protein binding	IPI	30970241
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	14521909
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IC	14521909
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	27184406
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005811	Component	Lipid droplet	IDA	27184406
GO:0005811	Component	Lipid droplet	IEA
GO:0005811	Component	Lipid droplet	IEA
GO:0005811	Component	Lipid droplet	ISS
GO:0005829	Component	Cytosol	IDA
GO:0006071	Process	Glycerol metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006640	Process	Monoacylglycerol biosynthetic process	IDA	28420705
GO:0006651	Process	Diacylglycerol biosynthetic process	IEA
GO:0006651	Process	Diacylglycerol biosynthetic process	ISS
GO:0007584	Process	Response to nutrient	IEA
GO:0008374	Function	O-acyltransferase activity	IEA
GO:0010867	Process	Positive regulation of triglyceride biosynthetic process	IEA
GO:0016020	Component	Membrane	IDA	11481335
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0019432	Process	Triglyceride biosynthetic process	IBA
GO:0019432	Process	Triglyceride biosynthetic process	IDA	11481335, 27184406
GO:0019432	Process	Triglyceride biosynthetic process	IEA
GO:0019432	Process	Triglyceride biosynthetic process	IEA
GO:0019432	Process	Triglyceride biosynthetic process	TAS
GO:0019915	Process	Lipid storage	IEA
GO:0019915	Process	Lipid storage	ISS
GO:0034383	Process	Low-density lipoprotein particle clearance	IEA
GO:0034383	Process	Low-density lipoprotein particle clearance	ISS
GO:0035336	Process	Long-chain fatty-acyl-CoA metabolic process	IDA	11481335
GO:0035336	Process	Long-chain fatty-acyl-CoA metabolic process	IEA
GO:0035356	Process	Intracellular triglyceride homeostasis	IEA
GO:0035356	Process	Intracellular triglyceride homeostasis	ISS
GO:0042572	Process	Retinol metabolic process	IEA
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0045722	Process	Positive regulation of gluconeogenesis	IEA
GO:0046322	Process	Negative regulation of fatty acid oxidation	IEA
GO:0046339	Process	Diacylglycerol metabolic process	IBA
GO:0046339	Process	Diacylglycerol metabolic process	IDA	11481335
GO:0046339	Process	Diacylglycerol metabolic process	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0050252	Function	Retinol O-fatty-acyltransferase activity	IEA
GO:0050746	Process	Regulation of lipoprotein metabolic process	IEA
GO:0055089	Process	Fatty acid homeostasis	IEA
GO:0055089	Process	Fatty acid homeostasis	ISS
GO:0060613	Process	Fat pad development	IEA
GO:0060613	Process	Fat pad development	ISS
GO:0071400	Process	Cellular response to oleic acid	IEA
GO:0071400	Process	Cellular response to oleic acid	ISS
GO:0090181	Process	Regulation of cholesterol metabolic process	IEA
GO:0097006	Process	Regulation of plasma lipoprotein particle levels	IEA
GO:0097006	Process	Regulation of plasma lipoprotein particle levels	ISS
GO:1990578	Component	Perinuclear endoplasmic reticulum membrane	IDA	27184406

MIM	HGNC	e!Ensembl
606983	16940	ENSG00000062282

Q96PD7

Protein name

Diacylglycerol O-acyltransferase 2 (EC 2.3.1.20) (Acyl-CoA retinol O-fatty-acyltransferase) (ARAT) (Retinol O-fatty-acyltransferase) (EC 2.3.1.76) (Diglyceride acyltransferase 2)

Protein function

Essential acyltransferase that catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for synthesis and storage of intracellular triglycerides (PubMed:271844

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03982	DAGAT	92 → 388	Diacylglycerol acyltransferase	Family

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in liver and white adipose tissue. Expressed at lower level in mammary gland, testis and peripheral blood leukocytes. Expressed in sebaceous glands of normal skin but decreased psoriatic skin. {ECO:0000269|PubMe

Sequence

MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLN
RSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKG
GRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATE
VSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGG
AAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQ
KKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHT
MYMEALVKLFDKHKTKFGLPETEVLEVN

Sequence length

388

Interactions

View interactions

	KEGG		Reactome
	Glycerolipid metabolism Metabolic pathways Fat digestion and absorption		Acyl chain remodeling of DAG and TAG Triglyceride biosynthesis

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Charcot-Marie-Tooth disease type 2A1	Uncertain significance	rs376527356	RCV003333813

Show/Hide Text Mining Associations (22)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	37247276
Carcinoma Hepatocellular	Associate	34440687
Carcinoma Hepatocellular	Inhibit	38644620
Carcinoma Renal Cell	Associate	36728187
Cardiovascular Diseases	Associate	31345219
Cerebral Hemorrhage	Associate	30836997
Dermatitis Atopic	Inhibit	35462437
Drug Related Side Effects and Adverse Reactions	Associate	35232775
Fatty Liver	Associate	38644620, 39241103
Hypertriglyceridemic Waist	Associate	22315393
Lung Diseases	Stimulate	32506038
Lymphoma Mantle Cell	Associate	34174847
Neoplasms	Associate	38644620
Neuroinflammatory Diseases	Associate	30836997
Non alcoholic Fatty Liver Disease	Associate	38644620
Obesity	Associate	17477860
Osteoporosis	Associate	29568943
Peripheral Nervous System Diseases	Associate	36741233
Peritonitis	Stimulate	32506038
Stomach Neoplasms	Associate	32506038
Virus Diseases	Associate	39241103
Weight Loss	Associate	17823443

DGAT2 (diacylglycerol O-acyltransferase 2)