Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8464
Gene name Gene Name - the full gene name approved by the HGNC.	SPT3 homolog, SAGA and STAGA complex component
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SUPT3H
Synonyms (NCBI Gene) Gene synonyms aliases	SPT3, SPT3L
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.1

Show/Hide all(31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029827	hsa-miR-26b-5p	Microarray	19088304
MIRT046510	hsa-miR-15b-5p	CLASH	23622248
MIRT1403516	hsa-miR-3160-3p	CLIP-seq
MIRT1403517	hsa-miR-3173-3p	CLIP-seq
MIRT1403518	hsa-miR-3616-3p	CLIP-seq
MIRT1403519	hsa-miR-3646	CLIP-seq
MIRT1403520	hsa-miR-3928	CLIP-seq
MIRT1403521	hsa-miR-4275	CLIP-seq
MIRT1403522	hsa-miR-4436b-3p	CLIP-seq
MIRT1403523	hsa-miR-4443	CLIP-seq
MIRT1403524	hsa-miR-4487	CLIP-seq
MIRT1403525	hsa-miR-4501	CLIP-seq
MIRT1403526	hsa-miR-4721	CLIP-seq
MIRT1403527	hsa-miR-4779	CLIP-seq
MIRT1403528	hsa-miR-548ag	CLIP-seq
MIRT1403529	hsa-miR-548ai	CLIP-seq
MIRT1403530	hsa-miR-558	CLIP-seq
MIRT1403531	hsa-miR-765	CLIP-seq
MIRT1403532	hsa-miR-873	CLIP-seq
MIRT2342956	hsa-miR-125a-3p	CLIP-seq
MIRT2342957	hsa-miR-1292	CLIP-seq
MIRT2342958	hsa-miR-1297	CLIP-seq
MIRT2342959	hsa-miR-224	CLIP-seq
MIRT2342960	hsa-miR-26a	CLIP-seq
MIRT2342961	hsa-miR-26b	CLIP-seq
MIRT2342962	hsa-miR-3659	CLIP-seq
MIRT2342963	hsa-miR-4465	CLIP-seq
MIRT2342964	hsa-miR-4471	CLIP-seq
MIRT2342965	hsa-miR-488	CLIP-seq
MIRT2342966	hsa-miR-498	CLIP-seq
MIRT2342967	hsa-miR-552	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000124	Component	SAGA complex	IDA	11564863
GO:0000124	Component	SAGA complex	IEA
GO:0000124	Component	SAGA complex	NAS	9674425, 19114550
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	11564863
GO:0005634	Component	Nucleus	IDA	9726987, 11564863
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9787080
GO:0005654	Component	Nucleoplasm	IDA
GO:0006282	Process	Regulation of DNA repair	NAS	11406595, 11564863
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	9787080, 17694077
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	9603525
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	9787080
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	TAS	9787080
GO:0033276	Component	Transcription factor TFTC complex	IDA	10373431
GO:0033276	Component	Transcription factor TFTC complex	NAS	10373431
GO:0043484	Process	Regulation of RNA splicing	NAS	11564863
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	9787080, 18206972
GO:0046982	Function	Protein heterodimerization activity	IEA

MIM	HGNC	e!Ensembl
602947	11466	ENSG00000196284

Protein

UniProt ID

O75486

Protein name

Transcription initiation protein SPT3 homolog (SPT3-like protein)

Protein function

Probable transcriptional activator.

PDB

7KTR , 7KTS , 8H7G

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02269	TFIID-18kDa	24 → 116	Transcription initiation factor IID, 18kD subunit	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues tested including pancreas, kidney, skeletal muscle, liver, lung, placenta, brain and heart.

Sequence

MNNTAASPMSTATSSSGRSTGKSISFATELQSMMYSLGDARRPLHETAVLVEDVVHTQLI
NLLQQAAEVSQLRGARVITPEDLLFLMRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLL
EDKLSGSNNANKRQKIAQDFLNSIDQTGELLAMFEDDEIDEVKQERMERAERQTRIMDSA
QYAEFCESRQLSFSKKASKFRDWLDCSSMEIKPNVVAMEILAYLAYETVAQLVDLALLVR
QDMVTKAGDPFSHAISATFIQYHNSAESTAACGVEAHSDAIQPCHIREAIRRYSHRIGPL
SPFTNAYRRNGMAFLAC

Sequence length

317

Interactions

View interactions

	KEGG
	Transcriptional misregulation in cancer

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma (childhood onset)	N/A	N/A	GWAS
Attention Deficit Hyperactivity Disorder	Attention deficit hyperactivity disorder	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Glaucoma	Glaucoma	N/A	N/A	GWAS
Otosclerosis	Otosclerosis	N/A	N/A	GWAS
Tremor	Essential tremor	N/A	N/A	GWAS

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	35589867
Cartilage Diseases	Associate	27701424
Disorders of Sex Development	Associate	24055526
Glioblastoma	Associate	35550147
Gonadal Dysgenesis 46 XY	Associate	24055526
Osteoarthritis	Associate	30010910
Osteoarthritis Knee	Associate	36089590

SUPT3H (SPT3 homolog, SAGA and STAGA complex component)