Gene Gene information from NCBI Gene database.
Entrez ID 8464
Gene name SPT3 homolog, SAGA and STAGA complex component
Gene symbol SUPT3H
Synonyms (NCBI Gene)
SPT3SPT3L
Chromosome 6
Chromosome location 6p21.1
miRNA miRNA information provided by mirtarbase database.
31
miRTarBase ID miRNA Experiments Reference
MIRT029827 hsa-miR-26b-5p Microarray 19088304
MIRT046510 hsa-miR-15b-5p CLASH 23622248
MIRT1403516 hsa-miR-3160-3p CLIP-seq
MIRT1403517 hsa-miR-3173-3p CLIP-seq
MIRT1403518 hsa-miR-3616-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0000124 Component SAGA complex IDA 11564863
GO:0000124 Component SAGA complex IEA
GO:0000124 Component SAGA complex NAS 9674425, 19114550
GO:0003713 Function Transcription coactivator activity IBA
GO:0003713 Function Transcription coactivator activity IDA 11564863
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602947 11466 ENSG00000196284
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75486
Protein name Transcription initiation protein SPT3 homolog (SPT3-like protein)
Protein function Probable transcriptional activator.
PDB 7KTR , 7KTS , 8H7G
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02269 TFIID-18kDa 24 116 Transcription initiation factor IID, 18kD subunit Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues tested including pancreas, kidney, skeletal muscle, liver, lung, placenta, brain and heart.
Sequence
MNNTAASPMSTATSSSGRSTGKSISFATELQSMMYSLGDARRPLHETAVLVEDVVHTQLI
NLLQQAAEVSQLRGARVITPEDLLFLMRKDKKKLRRLLKYMFIRDYKSKIVKGIDE
DDLL
EDKLSGSNNANKRQKIAQDFLNSIDQTGELLAMFEDDEIDEVKQERMERAERQTRIMDSA
QYAEFCESRQLSFSKKASKFRDWLDCSSMEIKPNVVAMEILAYLAYETVAQLVDLALLVR
QDMVTKAGDPFSHAISATFIQYHNSAESTAACGVEAHSDAIQPCHIREAIRRYSHRIGPL
SPFTNAYRRNGMAFLAC
Sequence length 317
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Transcriptional misregulation in cancer  
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Thyroid cancer, nonmedullary, 1 Likely benign rs188596507 RCV005906341
Uterine carcinosarcoma Likely benign rs188596507 RCV005906340
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 35589867
Cartilage Diseases Associate 27701424
Disorders of Sex Development Associate 24055526
Glioblastoma Associate 35550147
Gonadal Dysgenesis 46 XY Associate 24055526
Osteoarthritis Associate 30010910
Osteoarthritis Knee Associate 36089590