Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	84639
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 1 family member 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL1F10
Synonyms (NCBI Gene) Gene synonyms aliases	FIL1-theta, FKSG75, IL-1HY2, IL-38, IL1-theta, IL1HY2
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q14.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the interleukin 1 cytokine family. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. This cytokine is thought to participate in a network of interleukin 1 fam

Show/Hide all(91)

miRTarBase ID	miRNA	Experiments	Reference
MIRT487502	hsa-miR-4780	PAR-CLIP	20371350
MIRT487501	hsa-miR-6780b-3p	PAR-CLIP	20371350
MIRT487500	hsa-miR-212-5p	PAR-CLIP	20371350
MIRT487499	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT487498	hsa-miR-4784	PAR-CLIP	20371350
MIRT487497	hsa-miR-3119	PAR-CLIP	20371350
MIRT487496	hsa-miR-642b-5p	PAR-CLIP	20371350
MIRT487495	hsa-miR-623	PAR-CLIP	20371350
MIRT487494	hsa-miR-204-5p	PAR-CLIP	20371350
MIRT487493	hsa-miR-211-5p	PAR-CLIP	20371350
MIRT487491	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT487489	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT487502	hsa-miR-4780	PAR-CLIP	20371350
MIRT487501	hsa-miR-6780b-3p	PAR-CLIP	20371350
MIRT487500	hsa-miR-212-5p	PAR-CLIP	20371350
MIRT487499	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT487498	hsa-miR-4784	PAR-CLIP	20371350
MIRT487497	hsa-miR-3119	PAR-CLIP	20371350
MIRT487496	hsa-miR-642b-5p	PAR-CLIP	20371350
MIRT487495	hsa-miR-623	PAR-CLIP	20371350
MIRT487494	hsa-miR-204-5p	PAR-CLIP	20371350
MIRT487493	hsa-miR-211-5p	PAR-CLIP	20371350
MIRT487492	hsa-miR-3692-3p	PAR-CLIP	20371350
MIRT487491	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT487489	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT487502	hsa-miR-4780	PAR-CLIP	23592263
MIRT487501	hsa-miR-6780b-3p	PAR-CLIP	23592263
MIRT487500	hsa-miR-212-5p	PAR-CLIP	23592263
MIRT487499	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT487498	hsa-miR-4784	PAR-CLIP	23592263
MIRT487497	hsa-miR-3119	PAR-CLIP	23592263
MIRT487496	hsa-miR-642b-5p	PAR-CLIP	23592263
MIRT487495	hsa-miR-623	PAR-CLIP	23592263
MIRT487494	hsa-miR-204-5p	PAR-CLIP	23592263
MIRT487493	hsa-miR-211-5p	PAR-CLIP	23592263
MIRT487492	hsa-miR-3692-3p	PAR-CLIP	23592263
MIRT487491	hsa-miR-4755-5p	PAR-CLIP	23592263
MIRT487489	hsa-miR-5006-3p	PAR-CLIP	23592263
MIRT487502	hsa-miR-4780	PAR-CLIP	20371350
MIRT487501	hsa-miR-6780b-3p	PAR-CLIP	20371350
MIRT487500	hsa-miR-212-5p	PAR-CLIP	20371350
MIRT487499	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT487498	hsa-miR-4784	PAR-CLIP	20371350
MIRT487497	hsa-miR-3119	PAR-CLIP	20371350
MIRT487496	hsa-miR-642b-5p	PAR-CLIP	20371350
MIRT487495	hsa-miR-623	PAR-CLIP	20371350
MIRT487494	hsa-miR-204-5p	PAR-CLIP	20371350
MIRT487493	hsa-miR-211-5p	PAR-CLIP	20371350
MIRT487491	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT487489	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT487502	hsa-miR-4780	PAR-CLIP	20371350
MIRT487501	hsa-miR-6780b-3p	PAR-CLIP	20371350
MIRT487500	hsa-miR-212-5p	PAR-CLIP	20371350
MIRT487499	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT487498	hsa-miR-4784	PAR-CLIP	20371350
MIRT487497	hsa-miR-3119	PAR-CLIP	20371350
MIRT487496	hsa-miR-642b-5p	PAR-CLIP	20371350
MIRT487495	hsa-miR-623	PAR-CLIP	20371350
MIRT487494	hsa-miR-204-5p	PAR-CLIP	20371350
MIRT487493	hsa-miR-211-5p	PAR-CLIP	20371350
MIRT487492	hsa-miR-3692-3p	PAR-CLIP	20371350
MIRT487491	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT487489	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT487502	hsa-miR-4780	PAR-CLIP	23592263
MIRT487501	hsa-miR-6780b-3p	PAR-CLIP	23592263
MIRT487500	hsa-miR-212-5p	PAR-CLIP	23592263
MIRT487499	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT487498	hsa-miR-4784	PAR-CLIP	23592263
MIRT487497	hsa-miR-3119	PAR-CLIP	23592263
MIRT487496	hsa-miR-642b-5p	PAR-CLIP	23592263
MIRT487495	hsa-miR-623	PAR-CLIP	23592263
MIRT487494	hsa-miR-204-5p	PAR-CLIP	23592263
MIRT487493	hsa-miR-211-5p	PAR-CLIP	23592263
MIRT487492	hsa-miR-3692-3p	PAR-CLIP	23592263
MIRT487491	hsa-miR-4755-5p	PAR-CLIP	23592263
MIRT487489	hsa-miR-5006-3p	PAR-CLIP	23592263
MIRT1064205	hsa-miR-23a	CLIP-seq
MIRT1064206	hsa-miR-23b	CLIP-seq
MIRT1064207	hsa-miR-23c	CLIP-seq
MIRT1064208	hsa-miR-34b	CLIP-seq
MIRT1064209	hsa-miR-450b-5p	CLIP-seq
MIRT1064210	hsa-miR-518a-5p	CLIP-seq
MIRT1064211	hsa-miR-527	CLIP-seq
MIRT1064212	hsa-miR-9	CLIP-seq
MIRT2247571	hsa-miR-1275	CLIP-seq
MIRT2247572	hsa-miR-4260	CLIP-seq
MIRT2247573	hsa-miR-4457	CLIP-seq
MIRT2247574	hsa-miR-4488	CLIP-seq
MIRT2247575	hsa-miR-4665-5p	CLIP-seq
MIRT2247576	hsa-miR-4697-5p	CLIP-seq
MIRT2247577	hsa-miR-548ad	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005149	Function	Interleukin-1 receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA

MIM	HGNC	e!Ensembl
615296	15552	ENSG00000136697

Protein

UniProt ID

Q8WWZ1

Protein name

Interleukin-1 family member 10 (IL-1F10) (Family of interleukin 1-theta) (FIL1 theta) (Interleukin-1 HY2) (IL-1HY2) (Interleukin-1 theta) (IL-1 theta) (Interleukin-38) (IL-38)

Protein function

Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononu

PDB

5BOW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00340	IL1	32 → 148	Interleukin-1 / 18	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in fetal skin, spleen and tonsil. Expressed mostly in the basal epithelia of skin and in proliferating B-cells of the tonsil.

Sequence

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLG
IQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGW
FLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Sequence length

152

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction		Interleukin-38 signaling Interleukin-36 pathway

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS

Show/Hide Text Mining Associations (28)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	28727766
Arthritis Psoriatic	Associate	16918024
Autism Spectrum Disorder	Inhibit	32601180
Autoimmune Diseases	Associate	26819499, 28727766, 34799942
Autoimmune Diseases	Inhibit	33125159
Carcinoma Squamous Cell	Inhibit	35833307
Cardiovascular Diseases	Associate	33125159
Colitis Ulcerative	Stimulate	30643810
Colorectal Neoplasms	Inhibit	31786620
Complex Regional Pain Syndromes	Associate	31217010
Coronary Artery Disease	Associate	21889313
COVID 19	Associate	36375233
Dry Eye Syndromes	Associate	34428579
Gout	Associate	39568029
Graves Disease	Inhibit	34799942, 36397279
Hashimoto Disease	Inhibit	34799942
Inflammation	Inhibit	32601180, 33125159, 35833307, 36016926, 36375233, 36932980
Inflammation	Associate	34428579
Inflammatory Bowel Diseases	Associate	30643810
Metabolic Syndrome	Associate	33125159
Neoplasms	Associate	28727766, 31786620
Overweight	Associate	33125159
Psoriasis	Inhibit	35833307
Respiratory System Abnormalities	Associate	33125159
Rhinitis Allergic	Associate	36932980
Sjogren's Syndrome	Stimulate	25902739
ST Elevation Myocardial Infarction	Stimulate	26819499
Thyroiditis Autoimmune	Associate	34799942

IL1F10 (interleukin 1 family member 10)