SLITRK2 (SLIT and NTRK like family member 2)

Gene

• Entrez ID: 84631
• Gene name: SLIT and NTRK like family member 2
• Gene symbol: SLITRK2
• Synonyms (NCBI Gene): CXorf1, CXorf2, SLITL1, TMEM257, XLID111
• Chromosome: X
• Chromosome location: Xq27.3
• Summary: This gene encodes an integral membrane protein that contains two N-terminal leucine-rich repeats domains and contains C-terminal regions similar to neurotrophin receptors. The encoded protein may play a role in modulating neurite activity. Alternatively s

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1369745	hsa-miR-103a	CLIP-seq
MIRT1369746	hsa-miR-107	CLIP-seq
MIRT1369747	hsa-miR-15a	CLIP-seq
MIRT1369748	hsa-miR-15b	CLIP-seq
MIRT1369749	hsa-miR-16	CLIP-seq
MIRT1369750	hsa-miR-195	CLIP-seq
MIRT1369751	hsa-miR-424	CLIP-seq
MIRT1369752	hsa-miR-4502	CLIP-seq
MIRT1369753	hsa-miR-497	CLIP-seq
MIRT1369754	hsa-miR-106a	CLIP-seq
MIRT1369755	hsa-miR-106b	CLIP-seq
MIRT1369756	hsa-miR-17	CLIP-seq
MIRT1369757	hsa-miR-20a	CLIP-seq
MIRT1369758	hsa-miR-20b	CLIP-seq
MIRT1369759	hsa-miR-3609	CLIP-seq
MIRT1369760	hsa-miR-4796-3p	CLIP-seq
MIRT1369761	hsa-miR-519d	CLIP-seq
MIRT1369762	hsa-miR-548ah	CLIP-seq
MIRT1369763	hsa-miR-93	CLIP-seq
MIRT2333095	hsa-miR-141	CLIP-seq
MIRT2333096	hsa-miR-188-3p	CLIP-seq
MIRT2333097	hsa-miR-200a	CLIP-seq
MIRT2333098	hsa-miR-3153	CLIP-seq
MIRT2333099	hsa-miR-4646-5p	CLIP-seq
MIRT2333100	hsa-miR-4668-5p	CLIP-seq
MIRT2333101	hsa-miR-532-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	35840571
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	35840571
GO:0005886	Component	Plasma membrane	TAS
GO:0007409	Process	Axonogenesis	IBA
GO:0007409	Process	Axonogenesis	IEA
GO:0007409	Process	Axonogenesis	IMP	35840571
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IDA	35840571
GO:0030425	Component	Dendrite	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0050807	Process	Regulation of synapse organization	IDA	27273464
GO:0050807	Process	Regulation of synapse organization	IMP	27273464
GO:0051965	Process	Positive regulation of synapse assembly	IBA
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0051965	Process	Positive regulation of synapse assembly	ISS
GO:0098978	Component	Glutamatergic synapse	IBA
GO:0098978	Component	Glutamatergic synapse	IDA	23345436, 27273464
GO:0098978	Component	Glutamatergic synapse	IMP	23345436, 27273464
GO:0098982	Component	GABA-ergic synapse	IDA	23345436, 27273464
GO:0098982	Component	GABA-ergic synapse	IMP	23345436, 27273464
GO:0099560	Process	Synaptic membrane adhesion	IDA	23345436
GO:0099560	Process	Synaptic membrane adhesion	IMP	23345436
GO:1905606	Process	Regulation of presynapse assembly	IDA	23345436
GO:1905606	Process	Regulation of presynapse assembly	IMP	23345436

Other IDs

• MIM: 300561
• HGNC: 13449
• e!Ensembl: ENSG00000185985

Protein

• UniProt ID: Q9H156
• Protein name: SLIT and NTRK-like protein 2
• Protein function: It is involved in synaptogenesis and promotes excitatory synapse differentiation (PubMed:27273464, PubMed:27812321, PubMed:35840571). Suppresses neurite outgrowth (By similarity). Involved in the negative regulation of NTRK2 (PubMed:35840571). {
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13855	LRR_8	86 → 146	Leucine rich repeat	Repeat
  PF13855	LRR_8	142 → 193	Leucine rich repeat	Repeat
  PF13855	LRR_8	399 → 459	Leucine rich repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Expressed predominantly in the cerebral cortex of the brain but also at low levels in the spinal cord and medulla. Also expressed in some astrocytic brain tumors such as astrocytomas, oligodendrogliomas, glioblastomas, gangliogliomas a
• Sequence:

  MLSGVWFLSVLTVAGILQTESRKTAKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPP
  QYRIYQLFLNGNLLTRLYPNEFVNYSNAVTLHLGNNGLQEIRTGAFSGLKTLKRLHLNNN
  KLEILREDTFLGLESLEYLQADYNYISAIEAGAFSKLNKLKVLILNDNLLLSLPSNVFRF
  VLLTHLDLRGNRLKVMPFAGVLEHIGGIMEIQLEENPWNCTCDLLPLKAWLDTITVFVGE
  IVCETPFRLHGKDVTQLTRQDLCPRKSASDSSQRGSHADTHVQRLSPTMNPALNPTRAPK
  ASRPPKMRNRPTPRVTVSKDRQSFGPIMVYQTKSPVPLTCPSSCVCTSQSSDNGLNVNCQ
  ERKFTNISDLQPKPTSPKKLYLTGNYLQTVYKNDLLEYSSLDLLHLGNNRIAVIQEGAFT
  NLTSLRRLYLNGNYLEVLYPSMFDGLQSLQYLYLEYNVIKEIKPLTFDALINLQLLFLNN
  NLLRSLPDNIFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQIDLQENPWDCTCDIMGL
  KDWTEHANSPVIINEVTCESPAKHAGEILKFLGREAICPDSPNLSDGTVLSMNHNTDTPR
  SLSVSPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKGVPSVPRNTNNL
  DVSSFQLQYGSYNTETHDKTDGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQEFSY
  SNLEEKKEEPATPAYTISATELLEKQATPREPELLYQNIAERVKELPSAGLVHYNFCTLP
  KRQFAPSYESRRQNQDRINKTVLYGTPRKCFVGQSKPNHPLLQAKPQSEPDYLEVLEKQT
  AISQL

• Sequence length: 845

Pathways

KEGG:

Cell adhesion molecules

Reactome:

Receptor-type tyrosine-protein phosphatases

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Intellectual developmental disorder, X-linked 111	Likely pathogenic; Pathogenic	rs2073068605, rs2073064247, rs2124181878, rs782072593	RCV003227996 RCV003227997 RCV003227998 RCV003227999	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual disability	Likely pathogenic; Pathogenic	rs2073068605, rs2073064247, rs2124181878, rs2124152159, rs782072593	RCV002267769 RCV002267770 RCV002267771 RCV002267772 RCV002267773	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DYSLEXIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Bipolar Disorder	Associate	19488044	★☆☆☆☆ Found in Text Mining only