Gene Gene information from NCBI Gene database.
Entrez ID 84620
Gene name ST6 beta-galactoside alpha-2,6-sialyltransferase 2
Gene symbol ST6GAL2
Synonyms (NCBI Gene)
SIAT2ST6GalII
Chromosome 2
Chromosome location 2q12.3
Summary This locus encodes a sialyltransferase. The encoded type II transmembrane protein catalyzes the transfer of sialic acid from CMP to an oligosaccharide substrate. Polymorphisms at this locus may be associated with variations in risperidone response in schi
miRNA miRNA information provided by mirtarbase database.
271
miRTarBase ID miRNA Experiments Reference
MIRT446147 hsa-miR-548ae-3p PAR-CLIP 22100165
MIRT446146 hsa-miR-548ah-3p PAR-CLIP 22100165
MIRT446145 hsa-miR-548aj-3p PAR-CLIP 22100165
MIRT446144 hsa-miR-548am-3p PAR-CLIP 22100165
MIRT446143 hsa-miR-548aq-3p PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0003835 Function Beta-galactoside alpha-2,6-sialyltransferase activity IBA
GO:0003835 Function Beta-galactoside alpha-2,6-sialyltransferase activity IDA 12235148
GO:0003835 Function Beta-galactoside alpha-2,6-sialyltransferase activity IEA
GO:0003835 Function Beta-galactoside alpha-2,6-sialyltransferase activity TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608472 10861 ENSG00000144057
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96JF0
Protein name Beta-galactoside alpha-2,6-sialyltransferase 2 (Alpha 2,6-ST 2) (EC 2.4.3.1) (CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2) (ST6Gal II) (ST6GalII) (hST6Gal II) (Sialyltransferase 2)
Protein function Transfers sialic acid from the donor of substrate CMP-sialic acid to galactose containing acceptor substrates. Has alpha-2,6-sialyltransferase activity toward oligosaccharides that have the Gal-beta-1,4-GlcNAc sequence at the non-reducing end of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00777 Glyco_transf_29 275 504 Glycosyltransferase family 29 (sialyltransferase) Family
Tissue specificity TISSUE SPECIFICITY: Weakly expressed in some tissues, such as small intestine, colon and fetal brain. {ECO:0000269|PubMed:12235148, ECO:0000269|PubMed:12603328}.
Sequence
MKPHLKQWRQRMLFGIFAWGLLFLLIFIYFTDSNPAEPVPSSLSFLETRRLLPVQGKQRA
IMGAAHEPSPPGGLDARQALPRAHPAGSFHAGPGDLQKWAQSQDGFEHKEFFSSQVGRKS
QSAFYPEDDDYFFAAGQPGWHSHTQGTLGFPSPGEPGPREGAFPAAQVQRRRVKKRHRRQ
RRSHVLEEGDDGDRLYSSMSRAFLYRLWKGNVSSKMLNPRLQKAMKDYLTANKHGVRFRG
KREAGLSRAQLLCQLRSRARVRTLDGTEAPFSALGWRRLVPAVPLSQLHPRGLRSCAVVM
SAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTTIRIINSQILTNPSHHFIDSS
LYKDVILVAWDPAPYSANLNLWYKKPDYNLFTPYIQHRQRNPNQPFYILHPKFIWQLWDI
IQENTKEKIQPNPPSSGFIGILIMMSMCREVHVYEYIPSVRQTELCHYHELYYDAACTLG
AYHPLLYEKLLVQRLNMGTQGDLH
RKGKVVLPGFQAVHCPAPSPVIPHS
Sequence length 529
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
  Sialic acid metabolism
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1 Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Atherosclerosis Associate 11781157
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorder Associate 28281572
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Associate 12841680, 28032858, 33260650
★☆☆☆☆
Found in Text Mining only
Calcinosis Cutis Associate 1544942
★☆☆☆☆
Found in Text Mining only
Carcinoma Pancreatic Ductal Associate 39260693
★☆☆☆☆
Found in Text Mining only
Coronary Disease Associate 24399302
★☆☆☆☆
Found in Text Mining only
Glaucoma Open Angle Associate 36727359
★☆☆☆☆
Found in Text Mining only
Inflammation Stimulate 39260693
★☆☆☆☆
Found in Text Mining only
Meningioma Associate 34943806
★☆☆☆☆
Found in Text Mining only
Multiple Myeloma Associate 35294519
★☆☆☆☆
Found in Text Mining only