Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84620
Gene name Gene Name - the full gene name approved by the HGNC.
ST6 beta-galactoside alpha-2,6-sialyltransferase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ST6GAL2
Synonyms (NCBI Gene) Gene synonyms aliases
SIAT2, ST6GalII
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q12.3
Summary Summary of gene provided in NCBI Entrez Gene.
This locus encodes a sialyltransferase. The encoded type II transmembrane protein catalyzes the transfer of sialic acid from CMP to an oligosaccharide substrate. Polymorphisms at this locus may be associated with variations in risperidone response in schi
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT446147 hsa-miR-548ae-3p PAR-CLIP 22100165
MIRT446146 hsa-miR-548ah-3p PAR-CLIP 22100165
MIRT446145 hsa-miR-548aj-3p PAR-CLIP 22100165
MIRT446144 hsa-miR-548am-3p PAR-CLIP 22100165
MIRT446143 hsa-miR-548aq-3p PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0003835 Function Beta-galactoside alpha-2,6-sialyltransferase activity IBA
GO:0003835 Function Beta-galactoside alpha-2,6-sialyltransferase activity IDA 12235148
GO:0003835 Function Beta-galactoside alpha-2,6-sialyltransferase activity IEA
GO:0003835 Function Beta-galactoside alpha-2,6-sialyltransferase activity TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608472 10861 ENSG00000144057
Protein
UniProt ID Q96JF0
Protein name Beta-galactoside alpha-2,6-sialyltransferase 2 (Alpha 2,6-ST 2) (EC 2.4.3.1) (CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2) (ST6Gal II) (ST6GalII) (hST6Gal II) (Sialyltransferase 2)
Protein function Transfers sialic acid from the donor of substrate CMP-sialic acid to galactose containing acceptor substrates. Has alpha-2,6-sialyltransferase activity toward oligosaccharides that have the Gal-beta-1,4-GlcNAc sequence at the non-reducing end of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00777 Glyco_transf_29 275 504 Glycosyltransferase family 29 (sialyltransferase) Family
Tissue specificity TISSUE SPECIFICITY: Weakly expressed in some tissues, such as small intestine, colon and fetal brain. {ECO:0000269|PubMed:12235148, ECO:0000269|PubMed:12603328}.
Sequence
MKPHLKQWRQRMLFGIFAWGLLFLLIFIYFTDSNPAEPVPSSLSFLETRRLLPVQGKQRA
IMGAAHEPSPPGGLDARQALPRAHPAGSFHAGPGDLQKWAQSQDGFEHKEFFSSQVGRKS
QSAFYPEDDDYFFAAGQPGWHSHTQGTLGFPSPGEPGPREGAFPAAQVQRRRVKKRHRRQ
RRSHVLEEGDDGDRLYSSMSRAFLYRLWKGNVSSKMLNPRLQKAMKDYLTANKHGVRFRG
KREAGLSRAQLLCQLRSRARVRTLDGTEAPFSALGWRRLVPAVPLSQLHPRGLRSCAVVM
SAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTTIRIINSQILTNPSHHFIDSS
LYKDVILVAWDPAPYSANLNLWYKKPDYNLFTPYIQHRQRNPNQPFYILHPKFIWQLWDI
IQENTKEKIQPNPPSSGFIGILIMMSMCREVHVYEYIPSVRQTELCHYHELYYDAACTLG
AYHPLLYEKLLVQRLNMGTQGDLH
RKGKVVLPGFQAVHCPAPSPVIPHS
Sequence length 529
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
  Sialic acid metabolism
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Atherosclerosis Associate 11781157
Autism Spectrum Disorder Associate 28281572
Breast Neoplasms Associate 12841680, 28032858, 33260650
Calcinosis Cutis Associate 1544942
Carcinoma Pancreatic Ductal Associate 39260693
Coronary Disease Associate 24399302
Glaucoma Open Angle Associate 36727359
Inflammation Stimulate 39260693
Meningioma Associate 34943806
Multiple Myeloma Associate 35294519